Aquaporin-3 Antibody - BSA Free Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: QLMIGCHLEQPPPSNEEENVKLAHVKHKEQI |
Predicted Species |
Mouse (94%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
AQP3 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (87%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Aquaporin-3 Antibody - BSA Free
Background
Aquaporin 3 is a water channel protein. Aquaporins are a family of small integral membrane proteins related to themajor intrinsic protein (MIP or AQP0). Aquaporin 3 is localized at the basal lateral membranes of collecting ductcells in the kidney. In addition to its water channel function, aquaporin 3 has been found to facilitate the transportof nonionic small solutes such as urea and glycerol, but to a smaller degree. It has been suggested that waterchannels can be functionally heterogeneous and possess water and solute permeation mechanisms. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, WB
Species: Eq, Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
Publications for Aquaporin-3 Antibody (NBP2-33872) (0)
There are no publications for Aquaporin-3 Antibody (NBP2-33872).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Aquaporin-3 Antibody (NBP2-33872) (0)
There are no reviews for Aquaporin-3 Antibody (NBP2-33872).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Aquaporin-3 Antibody (NBP2-33872). (Showing 1 - 1 of 1 FAQ).
-
I am from China and I would like to know more about your product number:NBL1-07638. We know that the theoretical MW of AQP3 protein is 31KD. But in your product specification, we can see that so many bands appear after overexpressing AQP3 with plasmid in 293 cell. Can you explain this phenomenon? Apart from theoretical strip, are all other nonspecific bands? Or is the AQP3 itself ?
- Yes, the theoretical size of AQP3 is 31 kDa, which would be expected under reduced conditions with a sample. We have not characterized any of the other bands in the overexpressed lysate lane. Because this is a native lysate, any modifications that may take place could cause smearing and extra bands in the lysate sample. AQP3 is extensively modified because it is a glycoprotein, glycosylation often shows up as multiple bands with smearing when run under native conditions. This overexpression lysate is meant to only act as a positive control in WB experiments requiring a native control. Furthermore, the lane on the right side of the blot is showing detection of the lysate using an anti-Flag tag antibody, since the construct used for overexpression contains a Flag tag.
Secondary Antibodies
| |
Isotype Controls
|
Additional Aquaporin-3 Products
Research Areas for Aquaporin-3 Antibody (NBP2-33872)
Find related products by research area.
|
Blogs on Aquaporin-3