Aquaporin-3 Antibody - BSA Free

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872] - Staining in human esophagus and skeletal muscle tissues . Corresponding AQP3 RNA-seq data are presented for the same ...read more
Immunocytochemistry/ Immunofluorescence: Aquaporin-3 Antibody [NBP2-33872] - Staining of human cell line RT4 shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872] - Staining of human esophagus shows membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872] - Staining of human kidney shows membranous positivity in cells in distal tubules.
Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872] - Staining of human prostate shows membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872] - Staining of human skin shows membranous positivity in epidermal cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Aquaporin-3 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit Aquaporin-3 Antibody - BSA Free (NBP2-33872) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QLMIGCHLEQPPPSNEEENVKLAHVKHKEQI
Predicted Species
Mouse (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AQP3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Aquaporin-3 Protein (NBP2-33872PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Aquaporin-3 Antibody - BSA Free

  • AQP-3
  • aquaglyceroporin-3
  • aquaporin 3 (GIL blood group)
  • aquaporin 3 (Gill blood group)
  • aquaporin 3
  • aquaporin-3
  • GIL
  • Gill blood group

Background

Aquaporin 3 is a water channel protein. Aquaporins are a family of small integral membrane proteins related to themajor intrinsic protein (MIP or AQP0). Aquaporin 3 is localized at the basal lateral membranes of collecting ductcells in the kidney. In addition to its water channel function, aquaporin 3 has been found to facilitate the transportof nonionic small solutes such as urea and glycerol, but to a smaller degree. It has been suggested that waterchannels can be functionally heterogeneous and possess water and solute permeation mechanisms. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-74682
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB600-749
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-87679
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-67247
Species: Hu
Applications: ICC/IF, WB
NBP1-30862
Species: Eq, Hu, Mu, Po
Applications: ICC/IF, IHC-Fr, WB
NBP1-30865
Species: Hu
Applications: IHC,  IHC-P, WB
AF009
Species: Hu
Applications: IHC, WB
NBP1-91676
Species: Hu
Applications: IHC,  IHC-P
NBP2-92773
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-90119
Species: Hu
Applications: IHC,  IHC-P
NBP1-80993
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF245
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-12446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IM, IP, KD, WB

Publications for Aquaporin-3 Antibody (NBP2-33872) (0)

There are no publications for Aquaporin-3 Antibody (NBP2-33872).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aquaporin-3 Antibody (NBP2-33872) (0)

There are no reviews for Aquaporin-3 Antibody (NBP2-33872). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Aquaporin-3 Antibody (NBP2-33872). (Showing 1 - 1 of 1 FAQ).

  1. I am from China and I would like to know more about your product number:NBL1-07638. We know that the theoretical MW of AQP3 protein is 31KD. But in your product specification, we can see that so many bands appear after overexpressing AQP3 with plasmid in 293 cell. Can you explain this phenomenon? Apart from theoretical strip, are all other nonspecific bands? Or is the AQP3 itself ? 
    • Yes, the theoretical size of AQP3 is 31 kDa, which would be expected under reduced conditions with a sample. We have not characterized any of the other bands in the overexpressed lysate lane. Because this is a native lysate, any modifications that may take place could cause smearing and extra bands in the lysate sample. AQP3 is extensively modified because it is a glycoprotein, glycosylation often shows up as multiple bands with smearing when run under native conditions.  This overexpression lysate is meant to only act as a positive control in WB experiments requiring a native control. Furthermore, the lane on the right side of the blot is showing detection of the lysate using an anti-Flag tag antibody, since the construct used for overexpression contains a Flag tag. 

Secondary Antibodies

 

Isotype Controls

Additional Aquaporin-3 Products

Research Areas for Aquaporin-3 Antibody (NBP2-33872)

Find related products by research area.

Blogs on Aquaporin-3

There are no specific blogs for Aquaporin-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aquaporin-3 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol AQP3
Uniprot