APPBP2 Antibody - BSA Free

Western Blot: APPBP2 Antibody [NBP3-35600] - Western blot analysis of various lysates using APPBP2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 35s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

APPBP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit APPBP2 Antibody - BSA Free (NBP3-35600) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 386-585 of human APPBP2 (NP_006371.2).
  
  Sequence:
  LEEIAIDCHNKETEQRLLQEAHDLHLSSLQLAKKAFGEFNVQTAKHYGNLGRLYQSMRKFKEAEEMHIKAIQIKEQLLGQEDYEVALSVGHLASLYNYDMNQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNWNRLRDRQYSVTDALEDVSTSPQSTEEVVQSFLISQNVEGPSC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: APPBP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 67 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for APPBP2 Antibody - BSA Free

• amyloid beta precursor protein (cytoplasmic tail) binding protein 2
• Amyloid beta precursor protein-binding protein 2
• amyloid protein-binding protein 2
• APP-BP2
• KIAA0228HS.84084
• PAT1amyloid beta precursor protein (cytoplasmic tail)-binding protein 2
• Protein interacting with APP tail 1

Background

APPBP2, or Amyloid protein-binding protein 2, consists of a 585 amino acid isoform that is 67 kDa, and is involved in protein transport and processing and the movement of certain molecules along microtubules. Research is currently being conducted with regards to APPBP2 and its relation to breast cancer, Alzheimer's disease, and herpes simplex. The protein has been linked to the regulation of Androgen receptors, and interacts with HIST1H3A, HIST1H3B, HIST1H3C, HIST1H3D, and HIST1H3E.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: APPBP2