APPBP2 Antibody - BSA Free

Staining of human cell line RH-30 shows localization to nucleoplasm.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

APPBP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit APPBP2 Antibody - BSA Free (NBP3-21310) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ALSVGHLASLYNYDMNQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNW
• Predicted Species: Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: APPBP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for APPBP2 Antibody - BSA Free

• amyloid beta precursor protein (cytoplasmic tail) binding protein 2
• Amyloid beta precursor protein-binding protein 2
• amyloid protein-binding protein 2
• APP-BP2
• KIAA0228HS.84084
• PAT1amyloid beta precursor protein (cytoplasmic tail)-binding protein 2
• Protein interacting with APP tail 1

Background

APPBP2, or Amyloid protein-binding protein 2, consists of a 585 amino acid isoform that is 67 kDa, and is involved in protein transport and processing and the movement of certain molecules along microtubules. Research is currently being conducted with regards to APPBP2 and its relation to breast cancer, Alzheimer's disease, and herpes simplex. The protein has been linked to the regulation of Androgen receptors, and interacts with HIST1H3A, HIST1H3B, HIST1H3C, HIST1H3D, and HIST1H3E.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: APPBP2