Home » Apolipoprotein M/ApoM » Apolipoprotein M/ApoM Antibodies » Apolipoprotein M/ApoM Antibody

Apolipoprotein M/ApoM Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Apolipoprotein M/ApoM Antibody [NBP2-48991] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)
Western Blot: Apolipoprotein M/ApoM Antibody [NBP2-48991] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)
Immunocytochemistry/ Immunofluorescence: Apolipoprotein M/ApoM Antibody [NBP2-48991] - Immunofluorescent staining of human cell line Hep G2 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: Apolipoprotein M/ApoM Antibody [NBP2-48991] - Staining of human small intestine shows positivity in plasma.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Apolipoprotein M/ApoM Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LNSIYQCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APOM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Apolipoprotein M/ApoM Recombinant Protein Antigen (NBP2-48991PEP)

Reactivity Notes

Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Apolipoprotein M/ApoM Antibody

  • Apolipoprotein M
  • APOM
  • apo-M
  • G3A
  • HSPC336
  • MGC22400
  • NG20
  • NG20-like protein
  • Protein G3a

Background

Apolipoprotein M is encoded by this gene is an apolipoprotein and member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. The encoded protein is secreted through the plasma membrane but remains membrane-bound, where it is involved in lipid transport. Two transcript variants encoding two different isoforms have been found for this gene, but only one of them has been fully characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Apolipoprotein
A-I/ApoA1 Antibody - ...
NBP2-52979
Flow Cytometry: Apolipoprotein A-I/ApoA1 Antibody [NBP2-52979] - An intracellular stain was performed on HepG2 cells with Apolipoprotein A-1/ApoA1 Antibody NBP2-52979 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1.0 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody, .
Western Blot: Apolipoprotein A-I/ApoA1 Antibody [NBP2-52979] - Western blot analysis using Apolipoprotein A-I/ApoA1 antibody. Harvested from mouse, separated on a 4-12 gradient gel by SDS-PAGE, transferred to PVDF membrane and blocked in 3% BSA/TBST. Probed with 1:8000 anti-apoA1 in 1%BSA/TBST, and detect edwith an anti-rabbit HRP secondary antibody using chemiluminescence. WB dilution 1: 8000, block before incubation overnight. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: Apolipoprotein A-I/ApoA1 Antibody - BSA Free [NBP2-52979] - HepG2 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with Apolipoprotein A-1/ApoA1 Antibody (NBP2-52979) at 1ug/ml overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
(1 Review)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
LRH-1/NR5A2
Antibody
NBP2-27196
Immunohistochemistry-Paraffin: LRH-1/NR5A2 Antibody [NBP2-27196] - Analysis of NR5A2/LRH1 in human pancreas tissue using NR5A2/LRH1 antibody at 5 ug/ml.
Western Blot: LRH-1/NR5A2 Antibody [NBP2-27196] - Analysis of NR5A2 in HEPG2 lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse NIH3T3 and 4) RAW lysate probed with 3 ug/ml of NR5A2 antibody. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
(1 Publication)
Species: Bv, Ca, Ch, ChHa, Eq, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, RM, Ze
Applications: IHC, IHC-P, KD, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(16 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
ABCA1 Antibody -
BSA Free
NB400-105
Dual RNAscope ISH-IHC: ABCA1 Antibody [NB400-105] - Formalin-fixed paraffin-embedded tissue sections of human prostate cancer were probed for ABCA1 mRNA (ACD RNAScope Probe, catalog # 432291; Fast Red chromogen, ACD catalog # 322360). Adjacent tissue section was processed for immunohistochemistry using rabbit polyclonal (Novus Biologicals catalog # NB400-105) at 1.5ug/mL with overnight incubation at 4 degrees Celsius followed by incubation with anti-rabbit IgG VisUCyte HRP Polymer Antibody (Catalog # VC003) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to glandular cells.
Immunohistochemistry-Paraffin: ABCA1 Antibody [NB400-105] - Detection of ABCA1 in human prostate epithelium showing luminal and membrane staining.
Western Blot: ABCA1 Antibody [NB400-105] - Analysis of ABCA1 in total cell lysates of RAW264.9 cells treated with vehicle (-) or 9-cisretinoic acid and 22Rhydroxycholesterol (+). Samples used for this testing were 40 ug of total cell post-nuclear lysate from each group.
(7 Reviews)
(379 Publications)
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
BAT3/BAG6 Antibody
AF6438
BAT3/BAG6 was detected in immersion fixed immature human dendritic cells using Sheep Anti-Human/Mouse/Rat BAT3/BAG6 Affinity-purified Polyclonal Antibody (Catalog # AF6438) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counter­stained with DAPI (blue). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of A431 human epithelial carcinoma cell line, HeLa human cervical epithelial carcinoma cell line, BaF3 mouse pro-B cell line, CH‑1 mouse B cell lymphoma cell line, and PC‑12 rat adrenal pheochromocytoma cell line. PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse/Rat BAT3/BAG6 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6438) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for BAT3/BAG6 at approximately 150 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu, Rt
Applications: ICC, WB
CD55/DAF Antibody
[Unconjugated]
AF2009
CD55/DAF was detected in immersion fixed paraffin-embedded sections of human colon cancer tissue using 15 µg/mL Goat Anti-Human CD55/DAF Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2009) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
CD55/DAF was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line (left panel, positive staining) and MOLT-4 human acute lymphoblastic leukemia cell line (right panel, negative staining) using Goat Anti-Human CD55/DAF Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2009) at 0.5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(5 Publications)
Species: Hu
Applications: ICC, IHC
HNF1 Antibody
NBP1-33596
Western Blot: HNF1 Antibody [NBP1-33596] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with HNF1 alpha antibody [N1N3] diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: HNF1 Antibody [NBP1-33596] - Analysis. Mouse tissue extracts (50 Ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with HNF1 alpha antibody [N1N3] diluted at 1:2000.
Western Blot: HNF1 Antibody [NBP1-33596] - Rat tissue extracts (50 ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with HNF1 alpha antibody [N1N3] diluted at 1:1000.
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
Transcobalamin II
Antibody
AF7895
Western blot shows lysates of HUVEC human umbilical vein endothelial cells and RPMI 8226 human multiple myeloma cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse/Rat Transcobalamin II Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7895) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Transcobalamin II at approximately 43 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Transcobalamin II was detected in immersion fixed paraffin-embedded sections of human kidney using Sheep Anti-Human/Mouse/Rat Transcobalamin II Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7895) at 10 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to the cytoplasm in epithelial cell convoluted tubules. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: IHC, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(3 Reviews)
(739 Publications)
Species: Hu
Applications: BA
Leptin/OB [HRP]
DLP00
(138 Publications)
Species: Hu
Applications: ELISA
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Analysis using Azide/BSA FREE version of NBP2-34294. Human Thyroid stained with Thyroglobulin Ab (2H11 + 6E1).
Immunohistochemistry: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Imaging of Mouse stomach tissue. Positive staining can only be observed inside the thyroid cells and the follicle in thyroid tissue. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Thyroglobulin staining in thyroid tissue of normal C57 mouse (Red). Dilution is 1:100. IHC-P image submitted by a verified customer review.
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Apolipoprotein
A-II/ApoA2 Antibody ( ...
NBP3-16168
Immunohistochemistry: Apolipoprotein A-II/ApoA2 Antibody (5F7U1) [NBP3-16168] - Analysis of rat liver using Apolipoprotein A-II/ApoA2 Rabbit mAb (NBP3-16168) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: Apolipoprotein A-II/ApoA2 Antibody (5F7U1) [NBP3-16168] - Western blot analysis of extracts of Human plasma cells, using Apolipoprotein A-II/ApoA2 antibody (NBP3-16168) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry: Apolipoprotein A-II/ApoA2 Antibody (5F7U1) [NBP3-16168] - Analysis of mouse liver using Apolipoprotein A-II/ApoA2 Rabbit mAb (NBP3-16168) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
PON1 Antibody
(4G8D3) - Azide and B ...
NBP2-80919
Western Blot: PON1 Antibody (4G8D3) - Azide and BSA Free [NBP2-80919] - Western blot analysis of PON1 in (1) HEK293 and (2) PON1 hIgGFc transfected HEK293 cell lysate. Image from the standard format of this antibody.
Western Blot: PON1 Antibody (4G8D3) - Azide and BSA Free [NBP2-80919] - Western blot analysis of PON1 in human plasma cell lysate. Image from the standard format of this antibody.
Western Blot: PON1 Antibody (4G8D3) - Azide and BSA Free [NBP2-80919] - Western blot analysis of PON1 in human PON1 recombinant protein. (Expected MW is 40.6 kDa). Image from the standard format of this antibody.
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF (-), IHC, IHC-P, WB
LIPC Antibody
NBP3-04922
Immunocytochemistry/Immunofluorescence: LIPC Antibody [NBP3-04922] - Analysis of A549 cells using LIPC antibody . Blue: DAPI for nuclear staining.
Species: Hu
Applications: ICC/IF, WB
LDLR Antibody (C7)
NBP1-78159
Immunocytochemistry/Immunofluorescence: LDL R Antibody (C7) [NBP1-78159] - Antibody was tested in HepG2 cells with FITC (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry: LDL R Antibody (C7) [NBP1-78159] - Analysis of an FFPE tissue section of human liver using LDL Receptor antibody (clone C7) with HRP-DAB based detection and hematoxylin counterstaining.
Immunocytochemistry/Immunofluorescence: LDL R Antibody (C7) [NBP1-78159] - Image from a customer review on porcine intestinal epithelial cells IPEC-J2.
(1 Review)
(22 Publications)
Species: Bv, Hu, Po, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western blot shows lysates of HEK293T human embryonic kidney cell line untreated (-) or treated (+) with 20 mJ/cm2 ultraviolet light (UV) with a 30 minute recovery. PVDF membrane was probed with 0.5 μg/mL of Rabbit Anti-Human Phospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-c‑Jun (S63) at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
c‑Junphosphorylated at S63 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line treated with Anisomycin using Rabbit Anti-HumanPhospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) at 1 μg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HEK293T human embryonic kidney cell line untreated (-) or treated (+) with 20 mJ/cm2 ultraviolet light (UV) with a 30 minute recovery, loaded at 0.2 mg/mL. A specific band was detected for Phospho-c‑Jun (S63) at approximately 49 kDa (as indicated) using 5 μg/mL of Rabbit Anti-Human Phospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system. Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
HNF-4 alpha/NR2A1
Antibody
NBP1-89679
Immunohistochemistry-Paraffin: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Staining in human duodenum and tonsil tissues using anti-HNF4A antibody. Corresponding HNF4A RNA-seq data are presented for the same tissues.
Western Blot: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Analysis in human cell lines Caco-2 and PC-3 using anti-HNF4A antibody. Corresponding HNF4A RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
HNF-3 beta/FoxA2
Antibody [Unconjugate ...
AF2400
Mouse splenocytes were fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. HNF‑3 beta /FoxA2/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human HNF‑3 beta /FoxA2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2400) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The E-RABP promoter was detected by standard PCR.
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, Jurkat human acute T cell leukemia cell line, and K562 human chronic myelogenous leukemia cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human HNF‑3 beta /FoxA2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2400) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for HNF‑3 beta /FoxA2 at approximately 48 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
HNF‑3 beta /FoxA2 was detected in immersion fixed endoderm differentiated BG01V human embryonic stem cells using 10 µg/mL Goat Anti-Human HNF‑3 beta /FoxA2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2400) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(56 Publications)
Species: Hu
Applications: ChIP, ICC, IHC, WB

Publications for Apolipoprotein M/ApoM Antibody (NBP2-48991) (0)

There are no publications for Apolipoprotein M/ApoM Antibody (NBP2-48991).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein M/ApoM Antibody (NBP2-48991) (0)

There are no reviews for Apolipoprotein M/ApoM Antibody (NBP2-48991). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Apolipoprotein M/ApoM Antibody (NBP2-48991) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Apolipoprotein M/ApoM Products

Bioinformatics Tool for Apolipoprotein M/ApoM Antibody (NBP2-48991)

Discover related pathways, diseases and genes to Apolipoprotein M/ApoM Antibody (NBP2-48991). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein M/ApoM Antibody (NBP2-48991)

Discover more about diseases related to Apolipoprotein M/ApoM Antibody (NBP2-48991).
 

Pathways for Apolipoprotein M/ApoM Antibody (NBP2-48991)

View related products by pathway.

Blogs on Apolipoprotein M/ApoM

There are no specific blogs for Apolipoprotein M/ApoM, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Apolipoprotein M/ApoM Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol APOM