Apolipoprotein M/ApoM Antibody

Images

 
Western Blot: Apolipoprotein M/ApoM Antibody [NBP2-48991] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)
Immunocytochemistry/ Immunofluorescence: Apolipoprotein M/ApoM Antibody [NBP2-48991] - Immunofluorescent staining of human cell line Hep G2 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: Apolipoprotein M/ApoM Antibody [NBP2-48991] - Staining of human small intestine shows positivity in plasma.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Apolipoprotein M/ApoM Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LNSIYQCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APOM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Apolipoprotein M/ApoM Recombinant Protein Antigen (NBP2-48991PEP)

Reactivity Notes

Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Apolipoprotein M/ApoM Antibody

  • Apolipoprotein M
  • APOM
  • apo-M
  • G3A
  • HSPC336
  • MGC22400
  • NG20
  • NG20-like protein
  • Protein G3a

Background

Apolipoprotein M is encoded by this gene is an apolipoprotein and member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. The encoded protein is secreted through the plasma membrane but remains membrane-bound, where it is involved in lipid transport. Two transcript variants encoding two different isoforms have been found for this gene, but only one of them has been fully characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-27196
Species: Bv, Ca, Ch, ChHa, Eq, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, RM, Ze
Applications: IHC, IHC-P, KD, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
AF6438
Species: Hu, Mu, Rt
Applications: ICC, WB
AF2009
Species: Hu
Applications: ICC, IHC
NBP1-33596
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
AF7895
Species: Hu
Applications: IHC, WB
210-TA
Species: Hu
Applications: BA
DLP00
Species: Hu
Applications: ELISA
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP3-16168
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-80919
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF (-), IHC, IHC-P, WB
NBP3-04922
Species: Hu
Applications: ICC/IF, WB
NBP1-78159
Species: Bv, Hu, Po, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-89679
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF2400
Species: Hu
Applications: ChIP, ICC, IHC, WB

Publications for Apolipoprotein M/ApoM Antibody (NBP2-48991) (0)

There are no publications for Apolipoprotein M/ApoM Antibody (NBP2-48991).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein M/ApoM Antibody (NBP2-48991) (0)

There are no reviews for Apolipoprotein M/ApoM Antibody (NBP2-48991). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Apolipoprotein M/ApoM Antibody (NBP2-48991) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Apolipoprotein M/ApoM Products

Bioinformatics Tool for Apolipoprotein M/ApoM Antibody (NBP2-48991)

Discover related pathways, diseases and genes to Apolipoprotein M/ApoM Antibody (NBP2-48991). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein M/ApoM Antibody (NBP2-48991)

Discover more about diseases related to Apolipoprotein M/ApoM Antibody (NBP2-48991).
 

Pathways for Apolipoprotein M/ApoM Antibody (NBP2-48991)

View related products by pathway.

Blogs on Apolipoprotein M/ApoM

There are no specific blogs for Apolipoprotein M/ApoM, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Apolipoprotein M/ApoM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APOM