Apolipoprotein E/ApoE Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Apolipoprotein E/ApoE Antibody - BSA Free (NBP2-49450) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: ARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQW |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
APOE |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
- Western Blot 0.04 - 0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Apolipoprotein E/ApoE Antibody - BSA Free
Background
Apolipoprotein E (APOE) is an apolipoprotein located in chylomicrons and intermediate-density lipoproteins that is necessary for the normal catabolism of triglyceride-rich lipoprotein constituents in the liver. APOE has recently been shown to be involseveral biological processes other than lipoprotein transport, including cognition and immunoregulation.
Lipoproteins are responsible for carrying cholesterol and other fats through the bloodstream as little packages and are essential for the normal breakdown of these molecules. In particular, apolipoprotein E is a major component of specific lipoproteins called very low-density lipoproteins (VLDL). A major function of VLDLs is to remove excess cholesterol from the blood and carry it to the liver for processing. Maintaining normal levels of cholesterol is essential for the prevention of cardiovascular diseases, including heart attacks and strokes.
The three Apo E isoforms are strongly associated with cardiovascular disease and Alzheimer's disease, so ApoE antibodies have become useful tools for research in both of these areas.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Publications for Apolipoprotein E/ApoE Antibody (NBP2-49450) (0)
There are no publications for Apolipoprotein E/ApoE Antibody (NBP2-49450).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Apolipoprotein E/ApoE Antibody (NBP2-49450) (0)
There are no reviews for Apolipoprotein E/ApoE Antibody (NBP2-49450).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Apolipoprotein E/ApoE Antibody (NBP2-49450) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Apolipoprotein E/ApoE Products
Research Areas for Apolipoprotein E/ApoE Antibody (NBP2-49450)
Find related products by research area.
|
Blogs on Apolipoprotein E/ApoE