Apolipoprotein E/ApoE Antibody - BSA Free

Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450] - Analysis in human liver and pancreas tissues. Corresponding APOE RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450] - Staining of human cerebral cortex, liver, pancreas and testis using Anti-APOE antibody NBP2-49450 (A) shows similar protein distribution across tissues to independent antibody NBP2-49565 (B).

Western Blot: Apolipoprotein E/ApoE Antibody [NBP2-49450] - Analysis in human plasma.

Immunocytochemistry/Immunofluorescence: Apolipoprotein E/ApoE Antibody [NBP2-49450] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Apolipoprotein E/ApoE Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: APOE
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Apolipoprotein E/ApoE Recombinant Protein Antigen (NBP2-49450PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Apolipoprotein E/ApoE Antibody - BSA Free

• APOE
• Apo-E
• Apolipoprotein E
• apolipoprotein E3
• late onset)
• MGC1571

Background

Apolipoprotein E (APOE) is an apolipoprotein located in chylomicrons and intermediate-density lipoproteins that is necessary for the normal catabolism of triglyceride-rich lipoprotein constituents in the liver. APOE has recently been shown to be involseveral biological processes other than lipoprotein transport, including cognition and immunoregulation.

Lipoproteins are responsible for carrying cholesterol and other fats through the bloodstream as little packages and are essential for the normal breakdown of these molecules. In particular, apolipoprotein E is a major component of specific lipoproteins called very low-density lipoproteins (VLDL). A major function of VLDLs is to remove excess cholesterol from the blood and carry it to the liver for processing. Maintaining normal levels of cholesterol is essential for the prevention of cardiovascular diseases, including heart attacks and strokes.

The three Apo E isoforms are strongly associated with cardiovascular disease and Alzheimer's disease, so ApoE antibodies have become useful tools for research in both of these areas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: APOE