Apolipoprotein CIII Antibody (3T7Y5)

Western Blot: Apolipoprotein CIII Antibody (3T7Y5) [NBP3-16093] - Western blot analysis of extracts of Human plasma cells, using Apolipoprotein CIII antibody (NBP3-16093) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.

Immunohistochemistry: Apolipoprotein CIII Antibody (3T7Y5) [NBP3-16093] - Immunofluorescence analysis of mouse liver using Apolipoprotein CIII Rabbit mAb (NBP3-16093) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: Apolipoprotein CIII Antibody (3T7Y5) [NBP3-16093] - Immunohistochemistry of paraffin-embedded human liver using Apolipoprotein CIII Rabbit mAb (NBP3-16093) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 3T7Y5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Apolipoprotein CIII Antibody (3T7Y5) Summary

• Description: Novus Biologicals Rabbit Apolipoprotein CIII Antibody (3T7Y5) (NBP3-16093) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-99 of human Apolipoprotein CIII (P02656). MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: APOC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 11 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Apolipoprotein CIII Antibody (3T7Y5)

• APOC3
• APOCIII
• Apo-CIII
• ApoC-III
• Apolipoprotein C3
• apolipoprotein C-III
• MGC150353

Background

At least 9 distinct polymorphic forms of apolipoproteins are known. The apolipoproteins act as stabilizers of the intact lipoprotein particles. Quantitative measurements of HDL, LDL and VLDL particles in human serum are often used to estimate an individuals' relative risk of coronary heart disease. In addition, quantitative immunological measurements of certain apolipoproteins (especially A-1 and B) have been suggested to be more accurate estimators of coronary heart disease than measurements of lipoprotein particles (especially HDL and LDL). This apo-lipoprotein antibody is derived from human plasma by density gradient ultracentrifugation and HPLC.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: APOC3