Recombinant Human Apolipoprotein C-II/ApoC2 GST (N-Term) Protein

Images

 
SDS-Page: Apolipoprotein C-II/ApoC2 Partial Recombinant Protein [H00000344-Q01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Apolipoprotein C-II/ApoC2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 23-101 of Human Apolipoprotein C-II/ApoC2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TQQPQQDEMPSPTLLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
APOC2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
34.43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Apolipoprotein C-II/ApoC2 GST (N-Term) Protein

  • APC2
  • APOC2
  • Apo-CII
  • apoC-II
  • Apolipoprotein C2
  • Apolipoprotein CII
  • Apolipoprotein C-II
  • MGC75082

Background

APOC2 - apolipoprotein C-II

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NB600-610
Species: Bv, Hu
Applications: ELISA, IHC, IHC-P, IP, WB
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-19860
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-75410
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00000341-M01
Species: Hu
Applications: ELISA, Flow, Func, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP3-04922
Species: Hu
Applications: ICC/IF, WB
NBP2-52932
Species: Hu
Applications: IHC, IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-66987
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB200-527
Species: Hu, Mu, Rt
Applications: IP, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP1-78159
Species: Bv, Hu, Po, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA, WB
NB400-139
Species: Ha, Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00000344-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01) (0)

There are no publications for Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01) (0)

There are no reviews for Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Apolipoprotein C-II/ApoC2 Products

Bioinformatics Tool for Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01)

Discover related pathways, diseases and genes to Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01)

Discover more about diseases related to Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01).
 

Pathways for Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01)

View related products by pathway.

PTMs for Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01)

Learn more about PTMs related to Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01).
 

Research Areas for Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01)

Find related products by research area.

Blogs on Apolipoprotein C-II/ApoC2

There are no specific blogs for Apolipoprotein C-II/ApoC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Apolipoprotein C-II/ApoC2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol APOC2