Home » Apolipoprotein C-II/ApoC2 » ApoC2 Peptides and Proteins » Recombinant Human Apolipoprotein C-II/ApoC2 GST (N-Term) Protein

Recombinant Human Apolipoprotein C-II/ApoC2 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
SDS-Page: Apolipoprotein C-II/ApoC2 Partial Recombinant Protein [H00000344-Q01]
SDS-Page: Apolipoprotein C-II/ApoC2 Partial Recombinant Protein [H00000344-Q01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human Apolipoprotein C-II/ApoC2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 23-101 of Human Apolipoprotein C-II/ApoC2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TQQPQQDEMPSPTLLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
APOC2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
34.43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Apolipoprotein C-II/ApoC2 GST (N-Term) Protein

  • APC2
  • APOC2
  • Apo-CII
  • apoC-II
  • Apolipoprotein C2
  • Apolipoprotein CII
  • Apolipoprotein C-II
  • MGC75082

Background

APOC2 - apolipoprotein C-II

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Lipoprotein
Lipase/LPL Antibody [ ...
AF7197
Lipoprotein Lipase/LPL was detected in immersion fixed paraffin-embedded sections of human heart using Goat Anti-Human/Mouse Lipoprotein Lipase/LPL Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7197) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cardiomyocytes. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Western blot shows lysates of SH‑SY5Y human neuroblastoma cell line and NMuMG mouse mammary gland epithelial cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Lipoprotein Lipase/LPL Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7197) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Lipoprotein Lipase/LPL at approximately 56 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Lipoprotein Lipase/LPL was detected in immersion fixed SH‑SY5Y human neuroblastoma cell line using Goat Anti-Human Lipoprotein Lipase/LPL Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7197) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips. This application has not been tested in mouse samples.
(2 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
Apolipoprotein
CIII Antibody
NB600-610
Immunohistochemistry-Paraffin: Apolipoprotein CIII Antibody [NB600-610] - Tissue: liver.
(1 Review)
(2 Publications)
Species: Bv, Hu
Applications: ELISA, IHC, IHC-P, IP, WB
Apolipoprotein
A-I/ApoA1 Antibody - ...
NBP2-52979
Flow Cytometry: Apolipoprotein A-I/ApoA1 Antibody [NBP2-52979] - An intracellular stain was performed on HepG2 cells with Apolipoprotein A-1/ApoA1 Antibody NBP2-52979 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1.0 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody, .
Western Blot: Apolipoprotein A-I/ApoA1 Antibody [NBP2-52979] - Western blot analysis using Apolipoprotein A-I/ApoA1 antibody. Harvested from mouse, separated on a 4-12 gradient gel by SDS-PAGE, transferred to PVDF membrane and blocked in 3% BSA/TBST. Probed with 1:8000 anti-apoA1 in 1%BSA/TBST, and detect edwith an anti-rabbit HRP secondary antibody using chemiluminescence. WB dilution 1: 8000, block before incubation overnight. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: Apolipoprotein A-I/ApoA1 Antibody [NBP2-52979] - HepG2 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-APOA1 at a 1:200 dilution overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(1 Review)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Plastin L Antibody
NBP2-19860
Western Blot: Plastin L Antibody [NBP2-19860] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with L-Plastin antibody diluted at 1:10000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: Plastin L Antibody [NBP2-19860] - arious whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with L-Plastin antibody diluted at 1:10000.
Immunocytochemistry/Immunofluorescence: Plastin L Antibody [NBP2-19860] - A431 cells were fixed in ice-cold MeOH for 5 min. Green: L-Plastin protein stained by L-Plastin antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Apolipoprotein
A-II/ApoA2 Antibody ( ...
NBP2-75410
Flow Cytometry: Apolipoprotein A-II/ApoA2 Antibody (JB70-35) [NBP2-75410] - Analysis of HepG2 cells with Apolipoprotein A II antibody at 1/100 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti-rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: Apolipoprotein A-II/ApoA2 Antibody (JB70-35) [NBP2-75410] - Staining Apolipoprotein A II in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Apolipoprotein A-II/ApoA2 Antibody (JB70-35) [NBP2-75410] - Staining Apolipoprotein A II in LOVO cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Apolipoprotein C1
Antibody (2E2-1A3)
H00000341-M01
Western Blot: Apolipoprotein C1 Antibody (2E2-1A3) [H00000341-M01] - Analysis of APOC1 expression in transfected 293T cell line by APOC1 monoclonal antibody (M01), clone 2E2-1A3.Lane 1: APOC1 transfected lysate(9 KDa).Lane 2: Non-transfected lysate.
Western Blot: Apolipoprotein C1 Antibody (2E2-1A3) [H00000341-M01] - APOC1 monoclonal antibody (M01), clone 2E2-1A3. Analysis of APOC1 expression in human liver.
(3 Publications)
Species: Hu
Applications: ELISA, Flow, Func, WB
Apolipoprotein
E/ApoE Antibody (WUE- ...
NB110-60531
Flow (Intracellular): Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - An intracellular stain was performed on HepG2 cells with NB110-60531AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.
Western Blot: Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - ApoE Antibody (WUE-4) [NB110-60531] - Detection of ApoE in human tissue lysate using NB110-60531. Lane 1: liver Lane 2: brain
Flow Cytometry: Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - ApoE Antibody (WUE-4) [NB110-60531] - Intracellular flow cytometric staining of 1 x 10^6 CHO (A) and HEK-293 (B) cells using ApoE antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
(2 Reviews)
(28 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Analysis using Azide/BSA FREE version of NBP2-34294. Human Thyroid stained with Thyroglobulin Ab (2H11 + 6E1).
Immunohistochemistry: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Imaging of Mouse stomach tissue. Positive staining can only be observed inside the thyroid cells and the follicle in thyroid tissue. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Thyroglobulin staining in thyroid tissue of normal C57 mouse (Red). Dilution is 1:100. IHC-P image submitted by a verified customer review.
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
LIPC Antibody
NBP3-04922
Immunocytochemistry/Immunofluorescence: LIPC Antibody [NBP3-04922] - Analysis of A549 cells using LIPC antibody . Blue: DAPI for nuclear staining.
Species: Hu
Applications: ICC/IF, WB
Apolipoprotein
A-IV/ApoA4 Antibody ( ...
NBP2-52932
Western Blot: Apolipoprotein A-IV/ApoA4 Antibody (CL0468) [NBP2-52932] - Lane 1: Marker [kDa], Lane 2: Human plasma
Immunohistochemistry-Paraffin: Apolipoprotein A-IV/ApoA4 Antibody (CL0468) [NBP2-52932] - Immunohistochemical analysis of paraffin-embedded human colon tissue using Apolipoprotein A-IV/ApoA4 antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Apolipoprotein A-IV/ApoA4 Antibody (CL0468) [NBP2-52932] - Staining of human fallopian tube shows strong immunoreactivity in plasma in blood vessels.
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
APC Antibody - BSA
Free
NB100-91662
Immunocytochemistry/Immunofluorescence: APC Antibody [NB100-91662] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-APC Antibody at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: APC Antibody [NB100-91662] - An intracellular stain was performed on HeLa cells with APC Antibody NB100-91662AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Immunohistochemistry-Paraffin: APC Antibody [NB100-91662] - Paraffin-embedded human colon carcinoma tissue.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Coagulation Factor
XIV/Protein C Antibod ...
NBP2-66987
Immunocytochemistry/Immunofluorescence: Coagulation Factor XIV/Protein C Antibody (JM93-61) [NBP2-66987] - Staining Protein C in 293T cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Coagulation Factor XIV/Protein C Antibody (JM93-61) [NBP2-66987] - Staining Protein C in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Coagulation Factor XIV/Protein C Antibody (JM93-61) [NBP2-66987] - Analysis of paraffin-embedded human kidney tissue using anti-Protein C antibody. Counter stained with hematoxylin.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Apolipoprotein
B/ApoB Antibody
NB200-527
Western Blot: Apolipoprotein B/ApoB Antibody [NB200-527] - Alcohol feeding significantly down-regulated ApoB expression in mouse liver. Image from verified customer review.
(2 Reviews)
(7 Publications)
Species: Hu, Mu, Rt
Applications: IP, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin was detected in immersion fixed BG01V human embryonic stem cells differentiated to hepatocytes using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. Cells were co-stained using Sheep Anti-Human CEBP alpha (Catalog # AF7094) and NorthernLights™ 493-conjugated Anti-Sheep IgG Secondary Antibody (green, Catalog # NL012). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Albumin was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 0.1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm and plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(5 Reviews)
(28 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
LDLR Antibody (C7)
NBP1-78159
Immunocytochemistry/Immunofluorescence: LDL R Antibody (C7) [NBP1-78159] - Antibody was tested in HepG2 cells with FITC (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry: LDL R Antibody (C7) [NBP1-78159] - Analysis of an FFPE tissue section of human liver using LDL Receptor antibody (clone C7) with HRP-DAB based detection and hematoxylin counterstaining.
Immunocytochemistry/Immunofluorescence: LDL R Antibody (C7) [NBP1-78159] - Image from a customer review on porcine intestinal epithelial cells IPEC-J2.
(1 Review)
(20 Publications)
Species: Bv, Hu, Po, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA, WB
Apolipoprotein A5
Antibody (1G5G9)
NB400-139
Western Blot: Apolipoprotein A5 Antibody (1G5G9) [NB400-139] - Analysis using anti- human APOA5 monoclonal antibody against human serum total protein (lane 2). Lane 1 is a MW standard.
Western Blot: Apolipoprotein A5 Antibody (1G5G9) [NB400-139] - Detection of Apo A5 in HepG2 cell lysate with NB400-139.
Flow Cytometry: Apolipoprotein A5 Antibody (1G5G9) [NB400-139] - Intracellular flow cytometric staining of 1 x 10^6 CHO (A) and HEK-293 (B) cells using Apolipoprotein A5 antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
(2 Publications)
Species: Ha, Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Complement C3
Antibody (11H9) - BSA ...
NB200-540
Flow Cytometry: Complement C3 Antibody (11H9) [NB200-540] - Left panel: FMO, Middle panel: No primary antibody control, Right panel: sample. Day 6 murine mammary tumors processed and stained for analysis with flow cytometry. The C3b+ population of CD45+ cells is what the gate in each sample is exhibiting. WB image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: Complement C3 Antibody (11H9) [NB200-540] - C3 protein fragments deposited on kidney cells of MPL-lpr mouse. Staining with antibody 11H9. Glomerular staining pattern. Fixation in 4% paraformaldehyde in PBS pH 7.4. Vibratome sections of 4 um. Pretreated with 3% hydrogen peroxide for 20 min to quench endogenous peroxidases. Microwaved in antigen unmasking solution for 2-5 minutes as antigen retrieval.
Immunohistochemistry-Paraffin: Complement C3 Antibody (11H9) [NB200-540] - Complement C3 protein in a FFPE tissue section of mouse lymph node using 1:100 dilution of Complement C3 antibody (clone 11H9) NB200-540. This representative photomicrograph shows a membrane-cytoplasmic immunopositivity in non-germinal center cells, and few cells developed an intense staining for this target protein.
(2 Reviews)
(15 Publications)
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Recombinant Human
Apolipoprotein C-II/A ...
H00000344-Q01
Recombinant Human Apolipoprotein C-II/ApoC2 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01) (0)

There are no publications for Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01) (0)

There are no reviews for Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Apolipoprotein C-II/ApoC2 Products

Bioinformatics Tool for Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01)

Discover related pathways, diseases and genes to Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01)

Discover more about diseases related to Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01).
 

Pathways for Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01)

View related products by pathway.

PTMs for Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01)

Learn more about PTMs related to Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01).
 

Research Areas for Apolipoprotein C-II/ApoC2 Partial Recombinant Protein (H00000344-Q01)

Find related products by research area.

Blogs on Apolipoprotein C-II/ApoC2

There are no specific blogs for Apolipoprotein C-II/ApoC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Apolipoprotein C-II/ApoC2 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol APOC2