Apolipoprotein A-II/ApoA2 Antibody


Western Blot: Apolipoprotein A-II/ApoA2 Antibody [NBP1-57716] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Western Blot: Apolipoprotein A-II/ApoA2 Antibody [NBP1-57716] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Apolipoprotein A-II/ApoA2 Antibody [NBP1-57716] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: Apolipoprotein A-II/ApoA2 Antibody [NBP1-57716] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: Apolipoprotein A-II/ApoA2 Antibody [NBP1-57716] - Human HepG2, Antibody Dilution: 1.0 ug/ml APOA2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Apolipoprotein A-II/ApoA2 Antibody Summary

Synthetic peptides corresponding to APOA2 (apolipoprotein A-II) The peptide sequence was selected from the N terminal of APOA2)(50ug). Peptide sequence MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against APOA2 and was validated on Western blot.
Theoretical MW
9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Apolipoprotein A-II/ApoA2 Antibody

  • Alp-2
  • APOA2
  • apoAII
  • Apo-AII
  • ApoA-II
  • Apolipoprotein A2
  • Apolipoprotein AII
  • Apolipoprotein A-II
  • Hdl-1


This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Rb
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, Simple Western
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for Apolipoprotein A-II/ApoA2 Antibody (NBP1-57716) (0)

There are no publications for Apolipoprotein A-II/ApoA2 Antibody (NBP1-57716).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein A-II/ApoA2 Antibody (NBP1-57716) (0)

There are no reviews for Apolipoprotein A-II/ApoA2 Antibody (NBP1-57716). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apolipoprotein A-II/ApoA2 Antibody (NBP1-57716) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Apolipoprotein A-II/ApoA2 Products

Bioinformatics Tool for Apolipoprotein A-II/ApoA2 Antibody (NBP1-57716)

Discover related pathways, diseases and genes to Apolipoprotein A-II/ApoA2 Antibody (NBP1-57716). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein A-II/ApoA2 Antibody (NBP1-57716)

Discover more about diseases related to Apolipoprotein A-II/ApoA2 Antibody (NBP1-57716).

Pathways for Apolipoprotein A-II/ApoA2 Antibody (NBP1-57716)

View related products by pathway.

Research Areas for Apolipoprotein A-II/ApoA2 Antibody (NBP1-57716)

Find related products by research area.

Blogs on Apolipoprotein A-II/ApoA2

There are no specific blogs for Apolipoprotein A-II/ApoA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Apolipoprotein A-II/ApoA2 Antibody and receive a gift card or discount.


Gene Symbol APOA2