APOL3 Antibody

Images

 
Western Blot: APOL3 Antibody [H00080833-B01P] - Analysis of APOL3 expression in transfected 293T cell line by APOL3 polyclonal antibody. Lane 1: APOL3 transfected lysate(36.50 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

APOL3 Antibody Summary

Immunogen
APOL3 (NP_055164.1, 1 a.a. - 331 a.a.) full-length human protein. MDSEKKRFTEEATKYFRERVSPVHLQILLTNNEAWKRFVTAAELPRDEADALYEALKKLRTYAAIEDEYVQQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEVHRGCTISNVVSSSTGAASGIMSLAGLVLAPFTAGTSLALTAAGVGLGAASAVTGITTSIVEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRGARILSATTSGIFLALDVVNLVYESKHLHEGAKSASAEELRRQAQELEENLMELTQIYQRLNPCHTH
Specificity
Reacts with apolipoprotein L, 3.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
APOL3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for APOL3 Antibody

  • APOLIII
  • apoL-III
  • apolipoprotein L, 3
  • apolipoprotein L3
  • Apolipoprotein L-III
  • CG12_1
  • CG121
  • CG12-1
  • TNF-inducible protein CG12-1

Background

This gene is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 6. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids, including cholesterol, and/or allow the binding of lipids to organelles. In addition, expression of this gene is up-regulated by tumor necrosis factor-alpha in endothelial cells lining the normal and atherosclerotic iliac artery and aorta. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89033
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-87689
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-67599
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-90127
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF8221
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
DCLU00
Species: Hu
Applications: ELISA
AF942
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
NB100-687
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-78159
Species: Bv, Hu, Po, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA, WB
AF4764
Species: Hu
Applications: ICC, IHC, WB
NBP2-45788
Species: Ce, Hu
Applications: IHC, IHC-P, WB
NBP1-26549
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-20883
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-93204
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14358
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DY3078
Species: Hu
Applications: ELISA
1310-SE
Species: Hu
Applications: EnzAct

Publications for APOL3 Antibody (H00080833-B01P) (0)

There are no publications for APOL3 Antibody (H00080833-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APOL3 Antibody (H00080833-B01P) (0)

There are no reviews for APOL3 Antibody (H00080833-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for APOL3 Antibody (H00080833-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional APOL3 Products

Bioinformatics Tool for APOL3 Antibody (H00080833-B01P)

Discover related pathways, diseases and genes to APOL3 Antibody (H00080833-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APOL3 Antibody (H00080833-B01P)

Discover more about diseases related to APOL3 Antibody (H00080833-B01P).
 

Pathways for APOL3 Antibody (H00080833-B01P)

View related products by pathway.

Research Areas for APOL3 Antibody (H00080833-B01P)

Find related products by research area.

Blogs on APOL3

There are no specific blogs for APOL3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APOL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APOL3
Entrez