APOBEC3F Antibody


Western Blot: APOBEC3F Antibody [NBP1-57372] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

APOBEC3F Antibody Summary

Synthetic peptides corresponding to APOBEC3F(apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F) The peptide sequence was selected from the middle region of APOBEC3F (NP_660341). Peptide sequence: MYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRL
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against APOBEC3F and was validated on Western blot.
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for APOBEC3F Antibody

  • apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F
  • Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3F
  • ARP8
  • BK150C2.4.MRNA
  • DNA dC->dU-editing enzyme APOBEC-3F
  • EC 3.5.4
  • EC 3.5.4.-
  • induced upon T-cell activation
  • KA6
  • MGC74891


This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control.This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt, Po, Bv, Eq, Rb, Ze
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB (-), IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB

Publications for APOBEC3F Antibody (NBP1-57372) (0)

There are no publications for APOBEC3F Antibody (NBP1-57372).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APOBEC3F Antibody (NBP1-57372) (0)

There are no reviews for APOBEC3F Antibody (NBP1-57372). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for APOBEC3F Antibody (NBP1-57372) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional APOBEC3F Products

Bioinformatics Tool for APOBEC3F Antibody (NBP1-57372)

Discover related pathways, diseases and genes to APOBEC3F Antibody (NBP1-57372). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APOBEC3F Antibody (NBP1-57372)

Discover more about diseases related to APOBEC3F Antibody (NBP1-57372).

Pathways for APOBEC3F Antibody (NBP1-57372)

View related products by pathway.

PTMs for APOBEC3F Antibody (NBP1-57372)

Learn more about PTMs related to APOBEC3F Antibody (NBP1-57372).

Blogs on APOBEC3F

There are no specific blogs for APOBEC3F, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our APOBEC3F Antibody and receive a gift card or discount.


Gene Symbol APOBEC3F