APOBEC3D Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Rabbit APOBEC3D Antibody - Azide and BSA Free (NBP2-92045) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 207-386 of human APOBEC3D (NP_689639.2). AMYPHIFYFHFKNLLKACGRNESWLCFTMEVTKHHSAVFRKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARHSNVNLTIFTARLCYFWDTDYQEGLCSLSQEGASVKIMGYKDFVSCWKNFVYSDDEPFKPWKGLQTNFRLLKRRLREILQ |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
APOBEC3D |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Western Blot 1:500-1:2000
|
| Theoretical MW |
47 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for APOBEC3D Antibody - Azide and BSA Free
Background
APOBEC3D is a member of the cytidine deaminase gene family. It is one of a group of related genes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Simple Western, WB
Species: Hu
Applications: Flow, PEP-ELISA, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP (-), Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for APOBEC3D Antibody (NBP2-92045) (0)
There are no publications for APOBEC3D Antibody (NBP2-92045).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for APOBEC3D Antibody (NBP2-92045) (0)
There are no reviews for APOBEC3D Antibody (NBP2-92045).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for APOBEC3D Antibody (NBP2-92045) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional APOBEC3D Products
Research Areas for APOBEC3D Antibody (NBP2-92045)
Find related products by research area.
|
Blogs on APOBEC3D