APOBEC3B Antibody

Images

 
Western Blot: APOBEC3B Antibody [NBP1-57516] - Sample Tissue: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate ...read more
Western Blot: APOBEC3B Antibody [NBP1-57516] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

APOBEC3B Antibody Summary

Immunogen
Synthetic peptides corresponding to APOBEC3B(apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3B) The peptide sequence was selected from the N terminal of APOBEC3B (NP_004891). Peptide sequence: NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APOBEC3B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against APOBEC3B and was validated on Western blot.
Theoretical MW
46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
APOBEC3B Lysate (NBP2-64893)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for APOBEC3B Antibody

  • APOBEC1L
  • apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3B
  • ARCD3
  • ARP4
  • bK150C2.2
  • cytidine deaminase
  • DJ742C19.2
  • EC 3.5.4
  • EC 3.5.4.-
  • FLJ21201
  • phorbolin 3
  • Phorbolin-1-related protein
  • phorbolin-2/3
  • PHRBNLphorbolin 2
  • probable DNA dC->dU-editing enzyme APOBEC-3B

Background

APOBEC3B is a member of the cytidine deaminase family. It is thought that these proteins may be RNA editing enzymes and have roles in growth or cell cycle control.This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53089
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06977
Species: Mu
Applications: WB, PEP-ELISA
NBP1-57372
Species: Hu
Applications: WB
NBP2-43639
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-527
Species: Hu, Mu
Applications: WB
NB600-1031
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC-P
NBP2-57602
Species: Hu
Applications: ICC/IF
NBP2-13286
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-90271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-88999
Species: Hu
Applications: IHC, IHC-P
NBP1-87424
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57516
Species: Hu
Applications: WB

Publications for APOBEC3B Antibody (NBP1-57516) (0)

There are no publications for APOBEC3B Antibody (NBP1-57516).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APOBEC3B Antibody (NBP1-57516) (0)

There are no reviews for APOBEC3B Antibody (NBP1-57516). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for APOBEC3B Antibody (NBP1-57516) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional APOBEC3B Products

Bioinformatics Tool for APOBEC3B Antibody (NBP1-57516)

Discover related pathways, diseases and genes to APOBEC3B Antibody (NBP1-57516). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APOBEC3B Antibody (NBP1-57516)

Discover more about diseases related to APOBEC3B Antibody (NBP1-57516).
 

Pathways for APOBEC3B Antibody (NBP1-57516)

View related products by pathway.

PTMs for APOBEC3B Antibody (NBP1-57516)

Learn more about PTMs related to APOBEC3B Antibody (NBP1-57516).

Blogs on APOBEC3B

There are no specific blogs for APOBEC3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APOBEC3B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APOBEC3B
Entrez
Uniprot