APOBEC3A Antibody

Images

 
Western Blot: APOBEC3A Antibody [NBP2-82648] - Host: Rabbit. Target Name: ABC3A. Sample Type: Fetal Kidney lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

APOBEC3A Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human APOBEC3A. Peptide sequence: AQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQ The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
APOBEC3A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for APOBEC3A Antibody

  • apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A
  • ARP3
  • bK150C2.1
  • EC 3.5.4
  • EC 3.5.4.-
  • phorbolin 1
  • phorbolin-1
  • PHRBNprobable DNA dC->dU-editing enzyme APOBEC-3A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010097-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP1-30955
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF1444
Species: Mu
Applications: IHC, WB
NBP2-75395
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-82073
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-39019
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14306
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-82512
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
MAB4675
Species: Mu
Applications: IHC, Neut, WB
NBP1-88838
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00057016-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
H00007873-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-88592
Species: Hu
Applications: IHC, IHC-P
NBP2-67632
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP3-13180
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-00131
Species: Hu
Applications: Flow, PEP-ELISA, WB
NBP1-88848
Species: Hu
Applications: IHC, IHC-P
NBP2-82648
Species: Hu
Applications: WB

Publications for APOBEC3A Antibody (NBP2-82648) (0)

There are no publications for APOBEC3A Antibody (NBP2-82648).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APOBEC3A Antibody (NBP2-82648) (0)

There are no reviews for APOBEC3A Antibody (NBP2-82648). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for APOBEC3A Antibody (NBP2-82648) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional APOBEC3A Products

Array NBP2-82648

Bioinformatics Tool for APOBEC3A Antibody (NBP2-82648)

Discover related pathways, diseases and genes to APOBEC3A Antibody (NBP2-82648). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APOBEC3A Antibody (NBP2-82648)

Discover more about diseases related to APOBEC3A Antibody (NBP2-82648).
 

Pathways for APOBEC3A Antibody (NBP2-82648)

View related products by pathway.

PTMs for APOBEC3A Antibody (NBP2-82648)

Learn more about PTMs related to APOBEC3A Antibody (NBP2-82648).
 

Research Areas for APOBEC3A Antibody (NBP2-82648)

Find related products by research area.

Blogs on APOBEC3A

There are no specific blogs for APOBEC3A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APOBEC3A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APOBEC3A