APEH Antibody

Images

 
Western Blot: APEH Antibody [NBP1-54953] - Titration: 0.2-1 ug/ml, Positive Control: NCI-H226 cell lysate.

Product Details

Summary
Product Discontinued
View other related APEH Primary Antibodies

Order Details


    • Catalog Number
      NBP1-54953
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

APEH Antibody Summary

Immunogen
Synthetic peptides corresponding to APEH(N-acylaminoacyl-peptide hydrolase) The peptide sequence was selected from the middle region of APEH. Peptide sequence GSTGFGQDSILSLPGNVGHQDVKDVQFAVEQVLQEEHFDASHVALMGGSH.
Clonality
Polyclonal
Host
Rabbit
Gene
APEH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against APEH and was validated on Western blot.
Theoretical MW
81 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for APEH Antibody

  • AARE
  • ACPH
  • acylamino-acid-releasing enzyme
  • acylaminoacyl-peptidase
  • Acyl-peptide hydrolase
  • APH
  • D3F15S2
  • D3S48EEC 3.4.19.1
  • DNF15S2
  • MGC2178
  • N-acylaminoacyl-peptide hydrolase
  • OPH
  • Oxidized protein hydrolase

Background

APEH is the enzyme acylpeptide hydrolase, which catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is further processed to acetate and a free amino acid by an aminoacylase. This gene is located within the same region of chromosome 3 (3p21) as the aminoacylase gene, and deletions at this locus are also associated with a decrease in aminoacylase activity. The acylpeptide hydrolase is a homotetrameric protein of 300 kDa with each subunit consisting of 732 amino acid residues. It can play an important role in destroying oxidatively damaged proteins in living cells. Deletions of this gene locus are found in various types of carcinomas, including small cell lung carcinoma and renal cell carcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86614
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31329
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-59594
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP2-67766
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56594
Species: Hu
Applications: WB, Flow
NBP2-67232
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46179
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00000053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-54953
Species: Hu
Applications: WB

Publications for APEH Antibody (NBP1-54953) (0)

There are no publications for APEH Antibody (NBP1-54953).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APEH Antibody (NBP1-54953) (0)

There are no reviews for APEH Antibody (NBP1-54953). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for APEH Antibody (NBP1-54953) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP1-54953

Bioinformatics Tool for APEH Antibody (NBP1-54953)

Discover related pathways, diseases and genes to APEH Antibody (NBP1-54953). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APEH Antibody (NBP1-54953)

Discover more about diseases related to APEH Antibody (NBP1-54953).

PTMs for APEH Antibody (NBP1-54953)

Learn more about PTMs related to APEH Antibody (NBP1-54953).
 

Research Areas for APEH Antibody (NBP1-54953)

Find related products by research area.

Blogs on APEH

There are no specific blogs for APEH, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APEH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APEH
Uniprot