APEH Antibody

Product Discontinued

APEH Antibody Summary

• Immunogen: Synthetic peptides corresponding to APEH(N-acylaminoacyl-peptide hydrolase) The peptide sequence was selected from the middle region of APEH. Peptide sequence GSTGFGQDSILSLPGNVGHQDVKDVQFAVEQVLQEEHFDASHVALMGGSH.
• Predicted Species: Mouse (100%), Rat (100%), Canine (93%), Equine (93%), Zebrafish (92%), Bovine (93%), Guinea Pig (100%), Rabbit (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: APEH
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against APEH and was validated on Western blot.
• Theoretical MW: 81 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for APEH Antibody

• AARE
• ACPH
• acylamino-acid-releasing enzyme
• acylaminoacyl-peptidase
• Acyl-peptide hydrolase
• APH
• D3F15S2
• D3S48EEC 3.4.19.1
• DNF15S2
• MGC2178
• N-acylaminoacyl-peptide hydrolase
• OPH
• Oxidized protein hydrolase

Background

APEH is the enzyme acylpeptide hydrolase, which catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is further processed to acetate and a free amino acid by an aminoacylase. This gene is located within the same region of chromosome 3 (3p21) as the aminoacylase gene, and deletions at this locus are also associated with a decrease in aminoacylase activity. The acylpeptide hydrolase is a homotetrameric protein of 300 kDa with each subunit consisting of 732 amino acid residues. It can play an important role in destroying oxidatively damaged proteins in living cells. Deletions of this gene locus are found in various types of carcinomas, including small cell lung carcinoma and renal cell carcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: APEH
• Uniprot:
  • P13798(Human)