APEG1 Antibody (2C2-2C7)

Images

 
Western Blot: APEG1 Antibody (2C2-2C7) [H00010290-M01] - Analysis of SPEG expression in transfected 293T cell line by APEG1 monoclonal antibody (M01), clone S2.Lane 1: SPEG transfected lysate (Predicted MW: 12.7 ...read more
Sandwich ELISA: APEG1 Antibody (2C2-2C7) [H00010290-M01] - Detection limit for recombinant GST tagged APEG1 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2C2-2C7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

APEG1 Antibody (2C2-2C7) Summary

Immunogen
APEG1 (AAH06346, 1 a.a. ~ 114 a.a) full length recombinant protein with GST tag.MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIR VQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAE RGDAGFYTCKAVNEYGARQCEARLEVRGE
Localization
Nuclear
Specificity
APEG1 - aortic preferentially expressed gene 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SPEG
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for APEG1 Antibody (2C2-2C7)

  • aortic preferentially expressed gene 1
  • Aortic preferentially expressed protein 1
  • APEG1
  • BPEG
  • EC 2.7.11
  • EC 2.7.11.1
  • KIAA1297APEG-1
  • MGC12676
  • nuclear protein, marker for differentiated aortic smooth muscle anddown-regulated with vascular injury
  • SPEG complex locus
  • SPEGalpha
  • SPEGbeta
  • striated muscle preferentially expressed protein kinase

Background

Expression of this gene is thought to serve as a marker for differentiated vascular smooth muscle cells which may have a role in regulating growth and differentiation of this cell type. The encoded protein is highly similar to the corresponding rat and mouse proteins. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of only one variant has been defined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06542
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-88818
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-38290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33726
Species: Hu
Applications: IHC, IHC-P
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB600-507
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00007357-M03
Species: Hu
Applications: WB, ELISA

Publications for APEG1 Antibody (H00010290-M01) (0)

There are no publications for APEG1 Antibody (H00010290-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APEG1 Antibody (H00010290-M01) (0)

There are no reviews for APEG1 Antibody (H00010290-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for APEG1 Antibody (H00010290-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional APEG1 Products

Bioinformatics Tool for APEG1 Antibody (H00010290-M01)

Discover related pathways, diseases and genes to APEG1 Antibody (H00010290-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APEG1 Antibody (H00010290-M01)

Discover more about diseases related to APEG1 Antibody (H00010290-M01).
 

Pathways for APEG1 Antibody (H00010290-M01)

View related products by pathway.

PTMs for APEG1 Antibody (H00010290-M01)

Learn more about PTMs related to APEG1 Antibody (H00010290-M01).
 

Research Areas for APEG1 Antibody (H00010290-M01)

Find related products by research area.

Blogs on APEG1

There are no specific blogs for APEG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APEG1 Antibody (2C2-2C7) and receive a gift card or discount.

Bioinformatics

Gene Symbol SPEG
Entrez
Uniprot