Apc4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Apc4 Antibody [NBP1-90138] - Staining of human cell line U-2 OS shows positivity in cytoskeleton (intermediate filaments).
Immunohistochemistry-Paraffin: Apc4 Antibody [NBP1-90138] - Staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Apc4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VTVVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQYVAGNGFRKVSCVLSSNLRHV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANAPC4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Apc4 Protein (NBP1-90138PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Apc4 Antibody

  • anaphase promoting complex subunit 4
  • anaphase-promoting complex subunit 4
  • APC4Cyclosome subunit 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-89095
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90136
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01128
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4497
Species: Hu
Applications: WB, Simple Western
NBP2-20389
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-77376
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-82886
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77375
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-20287
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89093
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Apc4 Antibody (NBP1-90138) (0)

There are no publications for Apc4 Antibody (NBP1-90138).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apc4 Antibody (NBP1-90138) (0)

There are no reviews for Apc4 Antibody (NBP1-90138). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Apc4 Antibody (NBP1-90138) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Apc4 Products

Bioinformatics Tool for Apc4 Antibody (NBP1-90138)

Discover related pathways, diseases and genes to Apc4 Antibody (NBP1-90138). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apc4 Antibody (NBP1-90138)

Discover more about diseases related to Apc4 Antibody (NBP1-90138).
 

Pathways for Apc4 Antibody (NBP1-90138)

View related products by pathway.

Research Areas for Apc4 Antibody (NBP1-90138)

Find related products by research area.

Blogs on Apc4

There are no specific blogs for Apc4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Apc4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANAPC4