Apc11 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: SPWCLDHSCDLFGITDQVSADGPRACRQGARRRLPAGVGPVLPLLPHALHPQVAARTAGAAALPHVPPGMEVQGV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ANAPC11 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50-1:200
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Apc11 Antibody - BSA Free
Background
APC11 (anaphase-promoting complex subunit 11) is a member of the E3 enzyme family. This protein contains a RING-H2 domain and has a molecular weight of approximately 9.8 kD. The APC11 protein is distributed diffusely in the cytoplasm and is located in the nucleus with discrete accumulation in granular structures. The APC11 protein is a probable catalytic unit in the APC complex. The APC11 protein functions with other members of the APC complex as a multisubunit cell cycle ubiquitin ligase, and a regulator of sister chromatid separation by degrading securins. In addition, this protein functions in ubiquitin-dependent cyclin catabolism, metaphase/anaphase transition, and spindle elongation. The APC11 protein comprises one subunit of the anaphase promoting complex including APC1-8, and other probable complex proteins APC9-11, Cdc26, Mnd2, Swm1. The APC complex is inactivated by protein kinase A and is activated by CDC20 and Cdh1. In addition to the APC complex proteins, APC11 has been shown to interact with Ubc4. The Poly6116 antibody has been shown to be useful for Western blotting of the human and mouse APC11 protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: IP, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB, ICC/IF, IHC
Publications for Apc11 Antibody (NBP1-90140) (0)
There are no publications for Apc11 Antibody (NBP1-90140).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Apc11 Antibody (NBP1-90140) (0)
There are no reviews for Apc11 Antibody (NBP1-90140).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Apc11 Antibody (NBP1-90140) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Apc11 Products
Research Areas for Apc11 Antibody (NBP1-90140)
Find related products by research area.
|
Blogs on Apc11