Apc11 Antibody

Images

 
Western Blot: Apc11 Antibody [NBP1-90140] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: Apc11 Antibody [NBP1-90140] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Apc11 Antibody [NBP1-90140] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Apc11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SPWCLDHSCDLFGITDQVSADGPRACRQGARRRLPAGVGPVLPLLPHALHPQVAARTAGAAALPHVPPGMEVQGV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANAPC11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Apc11 Protein (NBP1-90140PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Apc11 Antibody

  • anaphase promoting complex subunit 11 (yeast APC11 homolog)
  • anaphase promoting complex subunit 11
  • anaphase-promoting complex subunit 11
  • APC11 anaphase promoting complex subunit 11 homolog
  • APC11Hepatocellular carcinoma-associated RING finger protein
  • Apc11p
  • Cyclosome subunit 11
  • HSPC214
  • MGC882

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP2-01128
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4497
Species: Hu
Applications: WB, Simple Western
NBP2-20389
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77376
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85594
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-20287
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00143384-B01P
Species: Hu
Applications: WB, ELISA
NBP1-77157
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-89093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88742
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89095
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90140
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Apc11 Antibody (NBP1-90140) (0)

There are no publications for Apc11 Antibody (NBP1-90140).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apc11 Antibody (NBP1-90140) (0)

There are no reviews for Apc11 Antibody (NBP1-90140). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Apc11 Antibody (NBP1-90140) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Apc11 Products

Bioinformatics Tool for Apc11 Antibody (NBP1-90140)

Discover related pathways, diseases and genes to Apc11 Antibody (NBP1-90140). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apc11 Antibody (NBP1-90140)

Discover more about diseases related to Apc11 Antibody (NBP1-90140).
 

Pathways for Apc11 Antibody (NBP1-90140)

View related products by pathway.

Research Areas for Apc11 Antibody (NBP1-90140)

Find related products by research area.

Blogs on Apc11

There are no specific blogs for Apc11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Apc11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANAPC11