APBB2 Antibody - Azide and BSA Free Summary
| Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen |
APBB2 (ABM85666.1, 1 a.a. - 329 a.a.) full-length human protein. MAEEDLAPGKSSVAVNNCIRQLSYCKNDIRDTVGIWGEGKDMYLILENDMLSLVDPMDRSVLHSQPIVSIRVWGVGRDNGRDFAYVARDKDTRILKCHVFRCDTPAKAIATSLHEICSKIMAERKNAKALACSSLQERANVNLDVPLQDFPTPKTELVQKFHVQYLGMLPVDKPVGMDILNSAIENLMTSSNKEDWLSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAGNVSEAVQAACMLRYQKCLVARPPSQKVRPPPPPADSVTRRVTTNVKRGVLSLIDTLKQKRPVTEMP |
| Specificity |
This product is specific for Human APBB2 purified MaxPab mouse polyclonal antibody (B01P) [Gene ID: 323]. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
APBB2 |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for APBB2 Antibody - Azide and BSA Free
Background
Proteolytic cleavage of the Amyloid protein precursor (APP) gives rise to the beta-Amyloid and Amyloid A4 proteins, which are present in human platelets. Amyloid deposition is associated with type II diabetes, Down's syndrome and a variety of neurological disorders, including Alzheimer's disease. The Amyloid precursor protein (APP) undergoes alternative splicing, resulting in several isoforms. Proteolytic cleavage of APP leads to the formation of the 4 kDa Amyloid ®/A4 protein. This protein is involved in the formation of neurofibrillary tangles and plaques that characterize the senile plaques of Alzheimer patients. APLP1 (Amyloid precursor-like protein 1) and APLP2 are structurally similar to APP. Human APLP2 is a membrane- bound sperm protein that contains a region highly homologous to the transmembrane-cytoplasmic domains of APP found in brain plaques of Alzheimer disease patients.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IP, WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IB, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, IHC, ICFlow, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Publications for APBB2 Antibody (H00000323-B01P) (0)
There are no publications for APBB2 Antibody (H00000323-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for APBB2 Antibody (H00000323-B01P) (0)
There are no reviews for APBB2 Antibody (H00000323-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for APBB2 Antibody (H00000323-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional APBB2 Products
Research Areas for APBB2 Antibody (H00000323-B01P)
Find related products by research area.
|
Blogs on APBB2