APBA1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: APBA1 Antibody [NBP2-56155] - Staining of human cell line BJ shows localization to the Golgi apparatus.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

APBA1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHRGEDEPYSEPYADYGGLQEHVYEEIGDAPELDARDGLRLYEQERDE
Specificity
Specificity of human APBA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APBA1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for APBA1 Antibody

  • Adapter protein X11alpha
  • amyloid beta (A4) precursor protein-binding, family A, member 1
  • amyloid beta A4 precursor protein-binding family A member 1
  • D9S411Eadaptor protein X11alpha
  • LIN10
  • mint-1
  • MINT1amyloid beta (A4) precursor protein-binding, family A, member 1 (X11)
  • Neuronal Munc18-1-interacting protein 1
  • Neuron-specific X11 protein
  • phosphotyrosine-binding/-interacting domain (PTB)-bearing protein
  • UROP11
  • X11A
  • X11X11ALPHA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67381
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF6327
Species: Hu, Mu, Rt
Applications: WB
AF5689
Species: Hu
Applications: WB
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NB110-58360
Species: Hu, Mu, Rt
Applications: WB, IP
NBP2-76922
Species: Hu, Rt
Applications: WB, DB, ELISA, Flow, ICC/IF, IHC, ICC
NBP2-58781
Species: Hu
Applications: IHC, IHC-P
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, IHC, ICC
NBP1-80965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
MAB931
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-56155
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for APBA1 Antibody (NBP2-56155) (0)

There are no publications for APBA1 Antibody (NBP2-56155).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APBA1 Antibody (NBP2-56155) (0)

There are no reviews for APBA1 Antibody (NBP2-56155). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for APBA1 Antibody (NBP2-56155) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional APBA1 Products

Array NBP2-56155

Bioinformatics Tool for APBA1 Antibody (NBP2-56155)

Discover related pathways, diseases and genes to APBA1 Antibody (NBP2-56155). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APBA1 Antibody (NBP2-56155)

Discover more about diseases related to APBA1 Antibody (NBP2-56155).
 

Pathways for APBA1 Antibody (NBP2-56155)

View related products by pathway.

PTMs for APBA1 Antibody (NBP2-56155)

Learn more about PTMs related to APBA1 Antibody (NBP2-56155).
 

Research Areas for APBA1 Antibody (NBP2-56155)

Find related products by research area.

Blogs on APBA1

There are no specific blogs for APBA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APBA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APBA1