AP3S1 Antibody - BSA Free

Western Blot: AP3S1 Antibody [NBP2-88767] - WB Suggested Anti-AP3S1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: 293T cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

AP3S1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit AP3S1 Antibody - BSA Free (NBP2-88767) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human AP3S1. Peptide sequence: IDAQNKLEKSEAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLP The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AP3S1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for AP3S1 Antibody - BSA Free

• Adapter-related protein complex 3 sigma-1 subunit
• adaptor-related protein complex 3, sigma 1 subunit
• AP-3 complex sigma-3A subunit
• AP-3 complex subunit sigma-3A
• CLAPS3AP-3 complex subunit sigma-1
• Clathrin-associated/assembly/adapter protein, small 3
• clathrin-associated/assembly/adaptor protein, small 3 (22kD)
• Sigma3A
• sigma-3A-adaptin
• sigma3A-adaptin
• Sigma-adaptin 3a

Background

Part of the AP-3 complex, an adapter-related complex which is not clathrin-associated. The complex isassociated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles fromthe Golgi membrane and may be directly involved in trafficking to lysosomes

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AP3S1