AP3M2 Antibody - Azide and BSA Free

Western Blot: AP3M2 Antibody [H00010947-B01P] - Analysis of AP3M2 expression in transfected 293T cell line by AP3M2 polyclonal antibody. Lane 1: AP3M2 transfected lysate(45.98 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

AP3M2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse AP3M2 Antibody - Azide and BSA Free (H00010947-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: AP3M2 (NP_006794.1, 1 a.a. - 418 a.a.) full-length human protein. MIHSLFLINSSGDIFLEKHWKSVVSRSVCDYFFEAQERATEAENVPPVIPTPHHYLLSVYRHKIFFVAVIQTEVPPLFVIEFLHRVVDTFQDYFGVCSEPVIKDNVVVVYEVLEEMLDNGFPLATESNILKELIKPPTILRTVVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIIDKSGSTITAEIQGVIDACVKLTGMPDLTLSFMNPRLLDDVSFHPCVRFKRWESERILSFIPPDGNFRLLSYHVSAQNLVAIPVYVKHNISFRDSSSLGRFEITVGPKQTMGKTIEGVTVTSQMPKGVLNMSLTPSQGTHTFDPVTKMLSWDVGKINPQKLPSLKGTMSLQAGASKPDENPTINLQFKIQQLAISGLKVNRLDMYGEKYKPFKGIKYMTKAGKFQVRT
• Specificity: This product is specific for Human AP3M2 purified MaxPab mouse polyclonal antibody (B01P) [Gene ID: 10947].
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: AP3M2
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Mouse polyclonal antibody raised against a full-length human AP3M2 protein.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AP3M2 Antibody - Azide and BSA Free

• Adapter-related protein complex 3 mu-2 subunit
• adaptor-related protein complex 3, mu 2 subunit
• AP-3 complex subunit mu-2
• AP47B
• CLA20
• Clathrin assembly protein assembly protein complex 1 medium chain homolog 2
• Clathrin coat assembly protein AP47 homolog 2
• Clathrin coat-associated protein AP47 homolog 2
• clathrin-associated protein AP47 homolog 2
• Golgi adaptor AP-1 47 kDa protein homolog 2
• HA1 47 kDa subunit homolog 2
• HA1 47kDA subunit homolog 2
• mu3B-adaptin
• P47B

Background

AP3M2 encodes a subunit of the heterotetrameric adaptor-related protein comlex 3 (AP-3), which belongs to the adaptor complexes medium subunits family. The AP-3 complex plays a role in protein trafficking to lysosomes and specialized organelles.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AP3M2
• Uniprot:
  • NP_006794.1(Human)