AP-2 beta/TFAP2B Antibody (3G5-1D11)

Images

 
Western Blot: AP-2 beta/TFAP2B Antibody (3G5-1D11) [H00007021-M01] - Analysis of TFAP2B expression in transfected 293T cell line by TFAP2B monoclonal antibody (M01), clone 3G5-1D11.Lane 1: TFAP2B transfected lysate(49.3 ...read more
Immunocytochemistry/ Immunofluorescence: AP-2 beta/TFAP2B Antibody (3G5-1D11) [H00007021-M01] - Analysis of monoclonal antibody to TFAP2B on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3G5-1D11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AP-2 beta/TFAP2B Antibody (3G5-1D11) Summary

Immunogen
TFAP2B (AAH37225, 1 a.a. - 449 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGPYSSAPPLSHTPSSDFQPPYFPPPYQPLPYHQSQDPYSHVNDPYSLNPLHQPQQHPWGQRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMGDSLSLHGLGHPGMEDVQSVEDANNSGMNLLDQSVIKKVPVPPKSVTSLMMNKDGFLGGMSVNTGEVFCSVPGRLSLLSSTSKYKVTVGEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLRERLEKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYICETEFPAKAVSEYLNRQHTDPSDLHSRKNMLLATKQLCKEFTDLLAQDRTPIGNSRPSPILEPGIQSCLTHFSLITHGFGAPAICAALTALQNYLTEALKGMDKMFLNNTTTNRHTSGEGPGSKTGDKEEKHRK
Specificity
TFAP2B - transcription factor AP-2 beta (activating enhancer binding protein 2 beta)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TFAP2B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AP-2 beta/TFAP2B Antibody (3G5-1D11)

  • activating enhancer binding protein 2 beta
  • Activating enhancer-binding protein 2-beta
  • AP2 beta
  • AP-2 beta
  • AP-2B
  • AP2-B
  • AP2-beta
  • CHAR
  • MGC21381
  • TFAP2B
  • transcription factor AP-2 beta (activating enhancer binding protein 2 beta)
  • transcription factor AP-2 beta (activating enhancer-binding protein 2 beta)
  • transcription factor AP-2-beta

Background

This gene encodes a member of the AP-2 family of transcription factors. AP-2 proteins form homo- or hetero-dimers with other AP-2 family members and bind specific DNA sequences. They are thought to stimulate cell proliferation and suppress terminal differentiation of specific cell types during embryonic development. Specific AP-2 family members differ in their expression patterns and binding affinity for different promoters. This protein functions as both a transcriptional activator and repressor. Mutations in this gene result in autosomal dominant Char syndrome, suggesting that this gene functions in the differentiation of neural crest cell derivatives.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5059
Species: Hu
Applications: WB, IHC
NB110-60935
Species: Hu, Mu, Pm
Applications: WB
NBP1-87456
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92090
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-41103
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90558
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IF
NBP1-92093
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5269
Species: Hu, Mu
Applications: WB, IHC
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-24713
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC-P
NBP1-76997
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-76998
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-14148
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for AP-2 beta/TFAP2B Antibody (H00007021-M01) (0)

There are no publications for AP-2 beta/TFAP2B Antibody (H00007021-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP-2 beta/TFAP2B Antibody (H00007021-M01) (0)

There are no reviews for AP-2 beta/TFAP2B Antibody (H00007021-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AP-2 beta/TFAP2B Antibody (H00007021-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AP-2 beta/TFAP2B Products

Bioinformatics Tool for AP-2 beta/TFAP2B Antibody (H00007021-M01)

Discover related pathways, diseases and genes to AP-2 beta/TFAP2B Antibody (H00007021-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP-2 beta/TFAP2B Antibody (H00007021-M01)

Discover more about diseases related to AP-2 beta/TFAP2B Antibody (H00007021-M01).
 

Pathways for AP-2 beta/TFAP2B Antibody (H00007021-M01)

View related products by pathway.

PTMs for AP-2 beta/TFAP2B Antibody (H00007021-M01)

Learn more about PTMs related to AP-2 beta/TFAP2B Antibody (H00007021-M01).
 

Research Areas for AP-2 beta/TFAP2B Antibody (H00007021-M01)

Find related products by research area.

Blogs on AP-2 beta/TFAP2B

There are no specific blogs for AP-2 beta/TFAP2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AP-2 beta/TFAP2B Antibody (3G5-1D11) and receive a gift card or discount.

Bioinformatics

Gene Symbol TFAP2B
Entrez
OMIM
Uniprot