Annexin A9 Antibody - BSA Free

Immunohistochemistry-Paraffin: Annexin A9 Antibody [NBP1-90153] - Staining of human colon, kidney, lymph node and thyroid gland using Anti-ANXA9 antibody NBP1-90153 (A) shows similar protein distribution across tissues to independent antibody NBP1-90152 (B).

Analysis in human thyroid gland and skeletal muscle tissues using Anti-ANXA9 antibody. Corresponding ANXA9 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Annexin A9 Antibody [NBP1-90153] - Staining of human thyroid gland shows high expression.

Immunohistochemistry-Paraffin: Annexin A9 Antibody [NBP1-90153] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: Annexin A9 Antibody [NBP1-90153] - Staining of human lymph node.

Immunohistochemistry-Paraffin: Annexin A9 Antibody [NBP1-90153] - Staining of human kidney.

Immunohistochemistry-Paraffin: Annexin A9 Antibody [NBP1-90153] - Staining of human colon.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Annexin A9 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Annexin A9 Antibody - BSA Free (NBP1-90153) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NLERIVMALLQPTAQFDAQELRTALKASDSAVDVAIEILATRTPPQLQECLAVYKHNFQVEAVDDITSETSGIL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANXA9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Annexin A9 Protein (NBP1-90153PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Annexin A9 Antibody - BSA Free

• annexin 31
• annexin A9
• Annexin XXXI
• Annexin-31
• annexin-9
• ANX31pemphaxin
• Pemphaxin

Background

The annexins are a family of calcium-dependent phospholipid-binding proteins. Members of the annexin family contain 4 internal repeat domains, each of which includes a type II calcium-binding site. The calcium-binding sites are required for annexins to aggregate and cooperatively bind anionic phospholipids and extracellular matrix proteins. This gene encodes a divergent member of the annexin protein family in which all four homologous type II calcium-binding sites in the conserved tetrad core contain amino acid substitutions that ablate their function. However, structural analysis suggests that the conserved putative ion channel formed by the tetrad core is intact. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANXA9