Annexin A4 Antibody - BSA Free

Western Blot: Annexin A4 Antibody [NBP1-59120] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml

Immunohistochemistry: Annexin A4 Antibody [NBP1-59120] - Human Intestine

Western Blot: Annexin A4 Antibody [NBP1-59120] - Titration: 1.25ug/ml, Positive Control: Human Placenta.

• Reactivity: Hu, Rt, Po
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

Annexin A4 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ANXA4 (annexin A4) The peptide sequence was selected from the N terminal of ANXA4. Peptide sequence GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANXA4
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Reactivity Notes

Porcine reactivity reported in scientific literature (PMID: 25976747).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for Annexin A4 Antibody - BSA Free

• AIV
• Annexin A4
• annexin IV (placental anticoagulant protein II)
• Annexin IV
• annexin-4
• ANX4
• ANX4Carbohydrate-binding protein p33/p41
• ANXA4
• Chromobindin-4
• chromobindin-4,35-beta calcimedin
• DKFZp686H02120
• Endonexin I
• Lipocortin IV
• MGC75105
• P32.5
• PAP-II
• PIG28
• Placental anticoagulant protein II
• PP4-X
• proliferation-inducing gene 28
• proliferation-inducing protein 28
• Protein II
• ZAP36

Background

Annexin A4 (ANXA4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANXA4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANXA4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANXA4 is almost exclusively expressed in epithelial cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Annexin A4 Antibody (NBP1-59120)(1)

Publication using NBP1-59120

• Jalali BM, Bogacki M, Dietrich M et al. Proteomic analysis of porcine endometrial tissue during peri-implantation period reveals altered protein abundance. J Proteomics. 2015-05-12 [PMID: 25976747] (WB, Porcine)

Bioinformatics

• Gene Symbol: ANXA4
• Uniprot:
  • Q6LES2(Human)