ANKRD23 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ANKRD23 Antibody [NBP1-90599] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.

Staining of human cerebral cortex shows no positivity in neurons as expected.

Staining of human breast shows no cytoplasmic positivity in myoepithelial cells.

Analysis in control (vector only transfected HEK293T lysate) and ANKRD23 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ANKRD23 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ANKRD23 Antibody - BSA Free (NBP1-90599) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KRLRHRVPPRKPEPLVKPQSQAQVEPVGLEMFLKAAAENQEYLIDKYLTDGGDPNAHDKLHRTALHWAC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANKRD23
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ANKRD23 Protein (NBP1-90599PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ANKRD23 Antibody - BSA Free

• ankyrin repeat domain 23
• DARP
• diabetes-related ankyrin repeat protein
• MARP3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANKRD23
• Entrez:
  • 200539(Human)
• Uniprot:
  • Q86SG2(Human)