ANKK1 Recombinant Protein Antigen

Images

 
There are currently no images for ANKK1 Protein (NBP1-86849PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ANKK1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ANKK1.

Source: E.coli

Amino Acid Sequence: EVNEDISQELMDSDSGNYLKRALQLSDRKNLVPRDEELCIYENKVTPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQER

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ANKK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-86849.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ANKK1 Recombinant Protein Antigen

  • ankyrin repeat and kinase domain containing 1
  • ankyrin repeat and protein kinase domain-containing protein 1
  • EC 2.7.11
  • EC 2.7.11.1
  • PKK2
  • Protein kinase PKK2
  • SGK288
  • Sugen kinase 288
  • X-kinasesgK288

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001813-M01A
Species: Hu
Applications: WB, ELISA
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
AF6457
Species: Hu
Applications: WB
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
NBP2-48927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00006532-D01P
Species: Hu, Mu
Applications: WB
NBP1-83693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-00178
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-37397
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC

Publications for ANKK1 Protein (NBP1-86849PEP) (0)

There are no publications for ANKK1 Protein (NBP1-86849PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKK1 Protein (NBP1-86849PEP) (0)

There are no reviews for ANKK1 Protein (NBP1-86849PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for ANKK1 Protein (NBP1-86849PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for ANKK1 Protein (NBP1-86849PEP)

Discover related pathways, diseases and genes to ANKK1 Protein (NBP1-86849PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKK1 Protein (NBP1-86849PEP)

Discover more about diseases related to ANKK1 Protein (NBP1-86849PEP).
 

Pathways for ANKK1 Protein (NBP1-86849PEP)

View related products by pathway.

PTMs for ANKK1 Protein (NBP1-86849PEP)

Learn more about PTMs related to ANKK1 Protein (NBP1-86849PEP).

Blogs on ANKK1

There are no specific blogs for ANKK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ANKK1 Antibody
NBP1-28459

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ANKK1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKK1