Recombinant Human Angiopoietin-like Protein 7/ANGPTL7 Protein

Product Discontinued

Recombinant Human Angiopoietin-like Protein 7/ANGPTL7 Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-346 of Human ANGPTL7 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:MLKKPLSAVTWLCIFIVAFVSHPAWLQKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein is not active and should not be used for experiments requiring activity.
• Protein/Peptide Type: Recombinant Protein
• Gene: ANGPTL7

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Angiopoietin-like Protein 7/ANGPTL7 Protein

• angiopoietin-like 7
• Angiopoietin-like factor
• Angiopoietin-like Protein 7
• angiopoietin-related protein 7
• ANGPTL7
• AngX
• CDT6
• CDT6angiopoietin-like factor (CDT6)
• Cornea-derived transcript 6 protein
• dJ647M16.1
• RP4-647M16.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANGPTL7