Amylin Recombinant Protein Antigen

Images

 
There are currently no images for Amylin Recombinant Protein Antigen (NBP2-33680PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Amylin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IAPP.

Source: E. coli

Amino Acid Sequence: LVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IAPP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33680.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Amylin Recombinant Protein Antigen

  • AMYLIN
  • DAPamylin
  • Diabetes-associated peptide
  • IAP
  • Insulinoma amyloid peptide
  • Islet amyloid polypeptide (diabetes-associated peptide; amylin)
  • islet amyloid polypeptide

Background

Amylin is commonly found in pancreatic islets of patients suffering diabetes mellitus type II, or harboring an insulinoma. While the association of amylin with the development of type II diabetes has been known for some time, a direct causative role for amylin has been harder to establish. Recent results suggest that amylin, like the related beta amyloid (Abeta) associated with Alzheimer's disease, can induce apoptotic cell death in particular cultured cells, an effect that may be relevant to the development of type II diabetes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF8221
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NB500-201
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NB100-56311
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
MPTX20
Species: Mu
Applications: ELISA
H00004068-M01
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
NB500-201
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
AF4670
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, Neut, WB
AF8181
Species: Hu
Applications: IHC, KO, Simple Western, WB
AF8171
Species: Hu
Applications: IHC, Simple Western, WB
MAB2358
Species: Hu, Mu
Applications: ICC, IHC
NBP3-25355
Species: Dr, Hu, Mu
Applications: IHC,  IHC-P, WB
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, PEP-ELISA
NBP2-62664
Species: Hu
Applications: IHC,  IHC-P

Publications for Amylin Recombinant Protein Antigen (NBP2-33680PEP) (0)

There are no publications for Amylin Recombinant Protein Antigen (NBP2-33680PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Amylin Recombinant Protein Antigen (NBP2-33680PEP) (0)

There are no reviews for Amylin Recombinant Protein Antigen (NBP2-33680PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Amylin Recombinant Protein Antigen (NBP2-33680PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Amylin Products

Research Areas for Amylin Recombinant Protein Antigen (NBP2-33680PEP)

Find related products by research area.

Blogs on Amylin

There are no specific blogs for Amylin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Amylin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IAPP