AMY1C Antibody

Images

 
Western Blot: AMY1C Antibody [H00000278-D01P] - Analysis of AMY1C expression in human pancreas.
Western Blot: AMY1C Antibody [H00000278-D01P] - Analysis of AMY1C expression in HeLa.
Western Blot: AMY1C Antibody [H00000278-D01P] - Analysis of AMY1C expression in transfected 293T cell line by AMY1C polyclonal antibody.Lane 1: AMY1C transfected lysate(56.21 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AMY1C Antibody Summary

Immunogen
AMY1C (AAI56581.1, 1 a.a. - 511 a.a.) full-length human protein. MKLFWLLFTIGFCWAQYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Specificity
This product is specific for Human AMY1C purified MaxPab rabbit polyclonal antibody (D01P) [Gene ID: 278].
Clonality
Polyclonal
Host
Rabbit
Gene
AMY1C
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AMY1C Antibody

  • AMY1
  • AMY1C amylase, alpha 1C (salivary)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45492
Species: Hu
Applications: WB, IHC
AF4317
Species: Hu
Applications: WB
AF4636
Species: Mu
Applications: WB
H00005018-D01P
Species: Hu
Applications: WB, ICC/IF
NB600-302
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89101
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47615
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-40201
Species: Hu, Ca, Fe
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
AF6368
Species: Hu
Applications: IHC
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu
Applications: WB, IHC, IHC-P, IP

Publications for AMY1C Antibody (H00000278-D01P) (0)

There are no publications for AMY1C Antibody (H00000278-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMY1C Antibody (H00000278-D01P) (0)

There are no reviews for AMY1C Antibody (H00000278-D01P). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AMY1C Antibody (H00000278-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AMY1C Antibody Products

AMY1C H00000278-D01P

Related Products by Gene

Bioinformatics Tool for AMY1C Antibody (H00000278-D01P)

Discover related pathways, diseases and genes to AMY1C Antibody (H00000278-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMY1C Antibody (H00000278-D01P)

Discover more about diseases related to AMY1C Antibody (H00000278-D01P).

Blogs on AMY1C

There are no specific blogs for AMY1C, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AMY1C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AMY1C
Uniprot

Customers Who Bought This Also Bought