AMPK beta 2/PRKAB2 Recombinant Protein Antigen

Images

 
There are currently no images for AMPK beta 2/PRKAB2 Protein (NBP1-92286PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

AMPK beta 2/PRKAB2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRKAB2.

Source: E. coli

Amino Acid Sequence: MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRKAB2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92286.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AMPK beta 2/PRKAB2 Recombinant Protein Antigen

  • 5'-AMP-activated protein kinase, beta-2 subunit
  • AMPK beta 2
  • AMPK beta 2,5'-AMP-activated protein kinase subunit beta-2
  • AMPK beta-2 chain
  • AMPK subunit beta-2
  • MGC61468
  • PRKAB2
  • protein kinase, AMP-activated, beta 2 non-catalytic subunit

Background

PRKAB2 is encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2854
Species: Hu, Mu, Rt
Applications: IHC, WB
AF2850
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-22127
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-61796
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-37285
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-89153
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-94901
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
291-G1
Species: Hu
Applications: BA
MAB812
Species: Hu
Applications: CyTOF-ready, Flow
MAB289
Species: Hu
Applications: Simple Western, WB
DRP300
Species: Hu
Applications: ELISA
NBP1-89324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
H00007957-M02
Species: Hu, Mu, Rt
Applications: ELISA, IP, S-ELISA, WB
NBP1-83077
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-01142
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB

Publications for AMPK beta 2/PRKAB2 Protein (NBP1-92286PEP) (0)

There are no publications for AMPK beta 2/PRKAB2 Protein (NBP1-92286PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMPK beta 2/PRKAB2 Protein (NBP1-92286PEP) (0)

There are no reviews for AMPK beta 2/PRKAB2 Protein (NBP1-92286PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AMPK beta 2/PRKAB2 Protein (NBP1-92286PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AMPK beta 2/PRKAB2 Products

Research Areas for AMPK beta 2/PRKAB2 Protein (NBP1-92286PEP)

Find related products by research area.

Blogs on AMPK beta 2/PRKAB2

There are no specific blogs for AMPK beta 2/PRKAB2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AMPK beta 2/PRKAB2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKAB2