AMPK beta 2/PRKAB2 Antibody

Images

 
Western Blot: AMPK beta 2/PRKAB2 Antibody [H00005565-D01P] - Analysis of PRKAB2 expression in mouse kidney.
Western Blot: AMPK beta 2/PRKAB2 Antibody [H00005565-D01P] - Analysis of PRKAB2 expression in transfected 293T cell line by PRKAB2 polyclonal antibody.Lane 1: PRKAB2 transfected lysate(30.30 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AMPK beta 2/PRKAB2 Antibody Summary

Immunogen
PRKAB2 (NP_005390.1, 1 a.a. - 272 a.a.) full-length human protein. MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
Specificity
PRKAB2 - protein kinase, AMP-activated, beta 2 non-catalytic subunit,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRKAB2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AMPK beta 2/PRKAB2 Antibody

  • 5'-AMP-activated protein kinase, beta-2 subunit
  • AMPK beta 2
  • AMPK beta 2,5'-AMP-activated protein kinase subunit beta-2
  • AMPK beta-2 chain
  • AMPK subunit beta-2
  • MGC61468
  • PRKAB2
  • protein kinase, AMP-activated, beta 2 non-catalytic subunit

Background

The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBL1-14763
Species: Hu
NBP2-37285
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89153
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42173
Species: Hu
Applications: WB, ICC/IF, ICC
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-89324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
H00007957-M02
Species: Hu, Rt
Applications: WB, ELISA
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01142
Species: Hu, Mu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for AMPK beta 2/PRKAB2 Antibody (H00005565-D01P) (0)

There are no publications for AMPK beta 2/PRKAB2 Antibody (H00005565-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMPK beta 2/PRKAB2 Antibody (H00005565-D01P) (0)

There are no reviews for AMPK beta 2/PRKAB2 Antibody (H00005565-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AMPK beta 2/PRKAB2 Antibody (H00005565-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AMPK beta 2/PRKAB2 Products

Bioinformatics Tool for AMPK beta 2/PRKAB2 Antibody (H00005565-D01P)

Discover related pathways, diseases and genes to AMPK beta 2/PRKAB2 Antibody (H00005565-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMPK beta 2/PRKAB2 Antibody (H00005565-D01P)

Discover more about diseases related to AMPK beta 2/PRKAB2 Antibody (H00005565-D01P).
 

Pathways for AMPK beta 2/PRKAB2 Antibody (H00005565-D01P)

View related products by pathway.

PTMs for AMPK beta 2/PRKAB2 Antibody (H00005565-D01P)

Learn more about PTMs related to AMPK beta 2/PRKAB2 Antibody (H00005565-D01P).
 

Research Areas for AMPK beta 2/PRKAB2 Antibody (H00005565-D01P)

Find related products by research area.

Blogs on AMPK beta 2/PRKAB2

There are no specific blogs for AMPK beta 2/PRKAB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AMPK beta 2/PRKAB2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKAB2
Entrez
Uniprot