We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Aminopeptidase A/ENPEP Recombinant Protein Antigen

Images

 
There are currently no images for Aminopeptidase A/ENPEP Protein (NBP1-85774PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Aminopeptidase A/ENPEP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ENPEP.

Source: E. coli

Amino Acid Sequence: SHLPSSTASPSGPPAQDQDICPASEDESGQWKNFRLPDFVNPVHYDLHVKPLLEEDTYTGTVSISINLSAPTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFEYKKQEYVVVE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ENPEP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85774.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Aminopeptidase A/ENPEP Recombinant Protein Antigen

  • Aminopeptidase A
  • APA
  • AP-A
  • CD249 antigen
  • CD249
  • Differentiation antigen gp160
  • EAP
  • EC 3.4.11
  • EC 3.4.11.7
  • ENPEP
  • glutamyl aminopeptidase (aminopeptidase A)
  • glutamyl aminopeptidase
  • gp160

Background

Aminopeptidase A is a zinc-dependent metallopeptidase that selectively cleaves N-terminal Glu, or Asp residues from peptides. In mice, it is expressed on early B cells and on a subset of thymic cortical epithelial cells, but not on mature lymphocytes. Additionally, it is expressed on endothelial cells, intestinal epithelium, proximal renal tubules, and other non-hemopoietic tissues. In humans, angiotensin II is the the best-defined biologically active substrate of APA. Although its role in the immune response is still uncertain, its expression on renal cell carcinoma has been the focus of some cancer research studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2335
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF1180
Species: Hu
Applications: ICC, IHC, Simple Western, WB
AF6386
Species: Hu
Applications: IP, WB
DAN00
Species: Hu
Applications: ELISA
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-34031
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-54975
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-80963
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
AF4277
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP1-82847
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85774PEP
Species: Hu
Applications: AC

Publications for Aminopeptidase A/ENPEP Protein (NBP1-85774PEP) (0)

There are no publications for Aminopeptidase A/ENPEP Protein (NBP1-85774PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aminopeptidase A/ENPEP Protein (NBP1-85774PEP) (0)

There are no reviews for Aminopeptidase A/ENPEP Protein (NBP1-85774PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Aminopeptidase A/ENPEP Protein (NBP1-85774PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Aminopeptidase A/ENPEP Products

Research Areas for Aminopeptidase A/ENPEP Protein (NBP1-85774PEP)

Find related products by research area.

Blogs on Aminopeptidase A/ENPEP

There are no specific blogs for Aminopeptidase A/ENPEP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Aminopeptidase A/ENPEP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ENPEP