ALX3 Antibody

Images

 
Western Blot: ALX3 Antibody [NBP1-80285] - Titration: 2.5ug/ml, Positive Control: NIH/3T3 cell lysate.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALX3 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of mouse ALX3 (NP_031467). Peptide sequence MDPERCAPFSVGPAAGPYAAAGDEAPGPQGTPDAAPHLHPAPPRGPRLSR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALX3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 2.5 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ALX3 and was validated on Western blot.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ALX3 Antibody

  • ALX homeobox 3
  • aristaless-like homeobox 3
  • homeobox protein aristaless-like 3
  • MGC138212
  • MGC141988
  • Proline-rich transcription factor ALX3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45490
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008092-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-62710
Species: Hu
Applications: IHC, IHC-P
NBP1-97308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, DB, ICC/IF, IHC, IHC-P
NBP2-48570
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84476
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56177
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, IHC, IHC-P, IP
NBP1-83998
Species: Hu
Applications: IHC, IHC-P
NBP1-88163
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB7555
Species: Hu
Applications: WB, Simple Western
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
H00054766-M07
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF6116
Species: Hu
Applications: WB, ICC
NB100-56155
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-13816
Species: Hu
Applications: IHC, IHC-P
NBP1-80285
Species: Mu
Applications: WB

Publications for ALX3 Antibody (NBP1-80285) (0)

There are no publications for ALX3 Antibody (NBP1-80285).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALX3 Antibody (NBP1-80285) (0)

There are no reviews for ALX3 Antibody (NBP1-80285). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALX3 Antibody (NBP1-80285) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ALX3 Antibody (NBP1-80285)

Discover related pathways, diseases and genes to ALX3 Antibody (NBP1-80285). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALX3 Antibody (NBP1-80285)

Discover more about diseases related to ALX3 Antibody (NBP1-80285).
 

Pathways for ALX3 Antibody (NBP1-80285)

View related products by pathway.

PTMs for ALX3 Antibody (NBP1-80285)

Learn more about PTMs related to ALX3 Antibody (NBP1-80285).

Blogs on ALX3

There are no specific blogs for ALX3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALX3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALX3
Entrez
Uniprot