CCDC4 Antibody

Images

 
Western Blot: CCDC4 Antibody [NBP1-88163] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: CCDC4 Antibody [NBP1-88163] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoli fibrillar center.
Immunohistochemistry-Paraffin: CCDC4 Antibody [NBP1-88163] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunocytochemistry/ Immunofluorescence: CCDC4 Antibody [NBP1-88163] - Staining of human cell line U-2 OS shows positivity in nucleus, nucleoli and cytoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QYMQRKQQTSAFLRVFTDSLQNYLLSGSFPTPNPSSASEYGHLADVDPLSTSPVHTLGGWTSPATSESHGHPSSSTL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BEND4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CCDC4 Protein (NBP1-88163PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC4 Antibody

  • BEN domain containing 4
  • BEN domain-containing protein 4
  • CCDC4
  • coiled-coil domain containing 4
  • coiled-coil domain-containing protein 4
  • FLJ35632
  • FLJ43965

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7707-NP
Species: Hu
NBP1-97308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, DB, ICC/IF, IHC, IHC-P
NBP1-80285
Species: Mu
Applications: WB
NBP2-48570
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00338917-T01
Species: Hu
NBP1-85487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59160
Species: Hu
Applications: WB
H00054766-M07
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-20675
Species: Hu
Applications: WB, ICC/IF
AF6108
Species: Hu
Applications: IHC
NBP2-02117
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
H00051053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88163
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CCDC4 Antibody (NBP1-88163) (0)

There are no publications for CCDC4 Antibody (NBP1-88163).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC4 Antibody (NBP1-88163) (0)

There are no reviews for CCDC4 Antibody (NBP1-88163). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CCDC4 Antibody (NBP1-88163) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC4 Products

Bioinformatics Tool for CCDC4 Antibody (NBP1-88163)

Discover related pathways, diseases and genes to CCDC4 Antibody (NBP1-88163). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC4 Antibody (NBP1-88163)

Discover more about diseases related to CCDC4 Antibody (NBP1-88163).
 

Pathways for CCDC4 Antibody (NBP1-88163)

View related products by pathway.

PTMs for CCDC4 Antibody (NBP1-88163)

Learn more about PTMs related to CCDC4 Antibody (NBP1-88163).

Blogs on CCDC4

There are no specific blogs for CCDC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BEND4