AlphaA Crystallin/CRYAA Antibody (1T1F5) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 6-95 of human AlphaA Crystallin/CRYAA (P02489). QHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVE |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
CRYAA |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for AlphaA Crystallin/CRYAA Antibody (1T1F5)
Background
Lens proteins consist almost entirely of crystallins (about 95%). Crystallins are also found vertebrate skeletal muscle tissue. In the lens, their structural function is to assist in maintaining the proper refractive index of the lens. The mammalian lens contains 3 major classes of crystallins: alpha, beta, and gamma. Alpha-crystallin is the largest of the crystallins and is composed of 2 primary gene products--alpha-A and alpha-B. There are at least 5 different proteins comprising the beta-crystallins. The gamma-crystallins are monomeric, but there are at least 5 gamma crystallins identified in bovine and rat lens. Alpha-Crystallin comprises 40% of total lens protein composition. In addition to maintaining proper refractive index, it also functions in a chaperone like manner by preventing the formation of aggregates possibly leading to cataract formation. It is believed that the phosphorylated states of the alpha-crystallin occur in response to cellular stress and may serve a structural control function and play a role in protein maintenance. Alpha-B crystallin has been linked to Alexander®s disease where it accumulates in brain cells of those afflicted.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA, S-ELISA, WB
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Mu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Mu, Rt
Applications: WB, ICC/IF, IHC
Publications for AlphaA Crystallin/CRYAA Antibody (NBP3-16559) (0)
There are no publications for AlphaA Crystallin/CRYAA Antibody (NBP3-16559).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for AlphaA Crystallin/CRYAA Antibody (NBP3-16559) (0)
There are no reviews for AlphaA Crystallin/CRYAA Antibody (NBP3-16559).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for AlphaA Crystallin/CRYAA Antibody (NBP3-16559) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional AlphaA Crystallin/CRYAA Products
Research Areas for AlphaA Crystallin/CRYAA Antibody (NBP3-16559)
Find related products by research area.
|
Blogs on AlphaA Crystallin/CRYAA