beta B1 Crystallin Antibody

Images

 
Immunohistochemistry-Paraffin: beta B1 Crystallin Antibody [NBP2-68576] - Staining of human eye shows strong positivity in lens.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

beta B1 Crystallin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TTVPITSAKAAELPPGNYRLVVFELENFQGRRAEFSGECSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFRPIKMDAQE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRYBB1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
Recommended conditions for IHC,Retrieval method: HIER pH6
Control Peptide
beta B1 Crystallin Recombinant Protein Antigen (NBP2-68576PEP)
Publications
Read Publication using
NBP2-68576 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Rat (80%). Use in Mouse reported in scientific literature (PMID:33085740).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for beta B1 Crystallin Antibody

  • Beta-B1 crystallin
  • beta-crystallin B1
  • CATCN3
  • crystallin, beta B1
  • eye lens structural protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001415-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-32741
Species: Hu, Mu
Applications: ICC/IF, WB
H00001417-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-33010
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-46354
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, WB
H00001421-M03
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP1-47708
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-32557
Species: Hu, Mu
Applications: WB
NBP2-68799
Species: Hu
Applications: IHC, IHC-P
NBP3-12222
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-59197
Species: Hu
Applications: WB
MAB5695
Species: Hu, Mu
Applications: WB
NBP2-92773
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-24551
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00001412-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00001419-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP3-04895
Species: Hu, Mu, Rt
Applications: WB
NBP2-46573
Species: Hu, Rt
Applications: IHC, WB

Publications for beta B1 Crystallin Antibody (NBP2-68576)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for beta B1 Crystallin Antibody (NBP2-68576) (0)

There are no reviews for beta B1 Crystallin Antibody (NBP2-68576). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for beta B1 Crystallin Antibody (NBP2-68576) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional beta B1 Crystallin Products

Bioinformatics Tool for beta B1 Crystallin Antibody (NBP2-68576)

Discover related pathways, diseases and genes to beta B1 Crystallin Antibody (NBP2-68576). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for beta B1 Crystallin Antibody (NBP2-68576)

Discover more about diseases related to beta B1 Crystallin Antibody (NBP2-68576).
 

Pathways for beta B1 Crystallin Antibody (NBP2-68576)

View related products by pathway.

PTMs for beta B1 Crystallin Antibody (NBP2-68576)

Learn more about PTMs related to beta B1 Crystallin Antibody (NBP2-68576).
 

Research Areas for beta B1 Crystallin Antibody (NBP2-68576)

Find related products by research area.

Blogs on beta B1 Crystallin

There are no specific blogs for beta B1 Crystallin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our beta B1 Crystallin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRYBB1