Recombinant Human Alpha-TTP GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Alpha-TTP GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 179-278 of Human Alpha-TTP

Source: Wheat Germ (in vitro)

Amino Acid Sequence: IAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKERIHMHGNNYKQSLLQHFPDILPLEYGGEEFSMEDICQEWTNFIMKSEDYLSSISESIQ

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TTPA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Alpha-TTP GST (N-Term) Protein

  • alpha-tocopherol transfer protein
  • alphaTTP
  • Alpha-TTP
  • ataxia (Friedreich-like) with vitamin E deficiency
  • ATTP
  • AVED
  • tocopherol (alpha) transfer protein (ataxia (Friedreich-like) with vitamin Edeficiency)
  • tocopherol (alpha) transfer protein
  • TPP1
  • TTP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01346
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-56506
Species: Ma, Hu, Mar, Mu, Rt
Applications: ChIP, CyTOF-ready, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, Simple Western, WB
NB500-176
Species: Hu
Applications: WB
NBP2-55709
Species: Hu
Applications: ICC/IF, WB
NBP1-31133
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00065057-M02
Species: Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-85563
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-292
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB110-68281
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF (-), Simple Western, WB
NBP2-02105
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-77031
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
DADT130
Species: Hu
Applications: ELISA
NBP2-01743
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-49938
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP2-22527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
NB100-317
Species: Hu, Mu, Rt
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, WB
DSE100
Species: Hu
Applications: ELISA
NB100-74392
Species: Bv, Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for Alpha-TTP Partial Recombinant Protein (H00007274-Q01) (0)

There are no publications for Alpha-TTP Partial Recombinant Protein (H00007274-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Alpha-TTP Partial Recombinant Protein (H00007274-Q01) (0)

There are no reviews for Alpha-TTP Partial Recombinant Protein (H00007274-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Alpha-TTP Partial Recombinant Protein (H00007274-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Alpha-TTP Products

Bioinformatics Tool for Alpha-TTP Partial Recombinant Protein (H00007274-Q01)

Discover related pathways, diseases and genes to Alpha-TTP Partial Recombinant Protein (H00007274-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Alpha-TTP Partial Recombinant Protein (H00007274-Q01)

Discover more about diseases related to Alpha-TTP Partial Recombinant Protein (H00007274-Q01).
 

Pathways for Alpha-TTP Partial Recombinant Protein (H00007274-Q01)

View related products by pathway.

Blogs on Alpha-TTP

There are no specific blogs for Alpha-TTP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Alpha-TTP GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TTPA