Recombinant Human alpha-Methylacyl-CoA Racemase/AMACR Protein

Images

 
SDS-Page: Recombinant Human alpha-Methylacyl-CoA Racemase/AMACR Protein [H00023600-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human alpha-Methylacyl-CoA Racemase/AMACR Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-198 of Human AMACR full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNSMFKFFSVENSEIESVGSTSRTEHVGWWSTFLYDLQDSRWGIHGCWSNRTPVLRAADQRTWTKV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
AMACR

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human alpha-Methylacyl-CoA Racemase/AMACR Protein

  • 2-methylacyl-CoA racemase
  • alpha-Methylacyl-CoA Racemase
  • alphaMethylacylCoARacemase
  • AMACR
  • AMACRD
  • CBAS4
  • EC 5.1.99.4
  • RACE
  • RM

Background

AMACR( AAH09471, 1 a.a. - 199 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-04611
Species: Hu
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00023600-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for alpha-Methylacyl-CoA Racemase/AMACR Recombinant Protein (H00023600-P01) (0)

There are no publications for alpha-Methylacyl-CoA Racemase/AMACR Recombinant Protein (H00023600-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha-Methylacyl-CoA Racemase/AMACR Recombinant Protein (H00023600-P01) (0)

There are no reviews for alpha-Methylacyl-CoA Racemase/AMACR Recombinant Protein (H00023600-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alpha-Methylacyl-CoA Racemase/AMACR Recombinant Protein (H00023600-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional alpha-Methylacyl-CoA Racemase/AMACR Products

Bioinformatics Tool for alpha-Methylacyl-CoA Racemase/AMACR Recombinant Protein (H00023600-P01)

Discover related pathways, diseases and genes to alpha-Methylacyl-CoA Racemase/AMACR Recombinant Protein (H00023600-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alpha-Methylacyl-CoA Racemase/AMACR Recombinant Protein (H00023600-P01)

Discover more about diseases related to alpha-Methylacyl-CoA Racemase/AMACR Recombinant Protein (H00023600-P01).
 

Pathways for alpha-Methylacyl-CoA Racemase/AMACR Recombinant Protein (H00023600-P01)

View related products by pathway.

PTMs for alpha-Methylacyl-CoA Racemase/AMACR Recombinant Protein (H00023600-P01)

Learn more about PTMs related to alpha-Methylacyl-CoA Racemase/AMACR Recombinant Protein (H00023600-P01).
 

Research Areas for alpha-Methylacyl-CoA Racemase/AMACR Recombinant Protein (H00023600-P01)

Find related products by research area.

Blogs on alpha-Methylacyl-CoA Racemase/AMACR

There are no specific blogs for alpha-Methylacyl-CoA Racemase/AMACR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human alpha-Methylacyl-CoA Racemase/AMACR Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AMACR
Entrez