Alpha-mannosidase II Antibody (1G9)

Images

 
There are currently no images for Alpha-mannosidase II Antibody (H00004124-M01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1G9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Alpha-mannosidase II Antibody (1G9) Summary

Immunogen
MAN2A1 (NP_002363 1045 a.a. - 1144 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DIHLVNLRTIQSKVGNGHSNEAALILHRKGFDCRFSSKGTGLFCSTTQGKILVQKLLNKFIVESLTPSSLSLMHSPPGTQNISEINLSPMEISTFRIQLR
Localization
Golgi Apparatus
Specificity
MAN2A1 - mannosidase, alpha, class 2A, member 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAN2A1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publications using H00004124-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Alpha-mannosidase II Antibody (1G9)

  • alpha-mannosidase 2
  • AMan II
  • EC 3.2.1
  • EC 3.2.1.114
  • Golgi alpha-mannosidase II
  • golgi integral membrane protein 7
  • GOLIM7
  • Man II
  • MANA2MANII
  • Mannosidase alpha class 2A member 1
  • mannosidase, alpha type II
  • mannosidase, alpha, class 2A, member 1
  • Mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase

Background

This gene encodes a protein which is a member of family 38 of the glycosyl hydrolases. The protein is located in the Golgi and catalyzes the final hydrolytic step in the asparagine-linked oligosaccharide (N-glycan) maturation pathway. Mutations in the mouse homolog of this gene have been shown to cause a systemic autoimmune disease similar to human systemic lupus erythematosus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81326
Species: Hu
Applications: IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83159
Species: Hu
Applications: IHC, IHC-P
640-A3
Species: Mu
NB100-93414
Species: Hu
Applications: WB, PEP-ELISA
NBP2-37322
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-45868
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85732
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NBP1-27946
Species: Mu
Applications: B/N, Flow, IHC-Fr, IP
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
H00004124-M01
Species: Hu
Applications: WB, ELISA

Publications for Alpha-mannosidase II Antibody (H00004124-M01)(2)

Reviews for Alpha-mannosidase II Antibody (H00004124-M01) (0)

There are no reviews for Alpha-mannosidase II Antibody (H00004124-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Alpha-mannosidase II Antibody (H00004124-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Alpha-mannosidase II Products

Bioinformatics Tool for Alpha-mannosidase II Antibody (H00004124-M01)

Discover related pathways, diseases and genes to Alpha-mannosidase II Antibody (H00004124-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Alpha-mannosidase II Antibody (H00004124-M01)

Discover more about diseases related to Alpha-mannosidase II Antibody (H00004124-M01).
 

Pathways for Alpha-mannosidase II Antibody (H00004124-M01)

View related products by pathway.

PTMs for Alpha-mannosidase II Antibody (H00004124-M01)

Learn more about PTMs related to Alpha-mannosidase II Antibody (H00004124-M01).

Blogs on Alpha-mannosidase II

There are no specific blogs for Alpha-mannosidase II, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Alpha-mannosidase II Antibody (1G9) and receive a gift card or discount.

Bioinformatics

Gene Symbol MAN2A1
Entrez
OMIM
Uniprot