Alpha Fodrin Antibody

Images

 
Western Blot: Alpha Fodrin Antibody [NBP1-89460] - Analysis in human cell line HeLa.
Immunocytochemistry/ Immunofluorescence: Alpha Fodrin Antibody [NBP1-89460] - Immunofluorescent staining of human cell line A-431 shows localization to microtubules & vesicles.
Immunohistochemistry-Paraffin: Alpha Fodrin Antibody [NBP1-89460] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells and neuropil.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Alpha Fodrin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPTAN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Alpha Fodrin Protein (NBP1-89460PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Alpha Fodrin Antibody

  • Alpha-II spectrin
  • EIEE5
  • FLJ17738
  • FLJ44613
  • Fodrin alpha chain
  • NEAS
  • spectrin alpha chain, brain
  • spectrin, alpha, non-erythrocytic 1 (alpha-fodrin)
  • Spectrin, non-erythroid alpha chain
  • SPTA2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB120-3515
Species: Hu, Rt, Po, Bv, Ca, Fi, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, ICC
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-33548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-86088
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Alpha Fodrin Antibody (NBP1-89460) (0)

There are no publications for Alpha Fodrin Antibody (NBP1-89460).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Alpha Fodrin Antibody (NBP1-89460) (0)

There are no reviews for Alpha Fodrin Antibody (NBP1-89460). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Alpha Fodrin Antibody (NBP1-89460) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Alpha Fodrin Products

Bioinformatics Tool for Alpha Fodrin Antibody (NBP1-89460)

Discover related pathways, diseases and genes to Alpha Fodrin Antibody (NBP1-89460). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Alpha Fodrin Antibody (NBP1-89460)

Discover more about diseases related to Alpha Fodrin Antibody (NBP1-89460).
 

Pathways for Alpha Fodrin Antibody (NBP1-89460)

View related products by pathway.

Blogs on Alpha Fodrin

There are no specific blogs for Alpha Fodrin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Alpha Fodrin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPTAN1