alpha-Aminoadipate Aminotransferase Antibody

Images

 
Western Blot: alpha-Aminoadipate Aminotransferase Antibody [NBP1-53171] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

alpha-Aminoadipate Aminotransferase Antibody Summary

Immunogen
Synthetic peptides corresponding to AADAT(aminoadipate aminotransferase) The peptide sequence was selected from the middle region of AADAT. Peptide sequence EIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKI.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AADAT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against AADAT and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for alpha-Aminoadipate Aminotransferase Antibody

  • AADAT
  • alphaAminoadipate Aminotransferase
  • alpha-Aminoadipate Aminotransferase
  • aminoadipate aminotransferase
  • EC 2.6.1.39,2-aminoadipate aminotransferase
  • EC 2.6.1.7,2-aminoadipate transaminase
  • KAT/AadAT
  • KAT2
  • KAT2mitochondrial
  • Kynurenine aminotransferase II
  • Kynurenine--oxoglutarate aminotransferase II
  • Kynurenine--oxoglutarate transaminase II
  • L kynurenine/alpha aminoadipate aminotransferase

Background

AADAT is a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathw

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01383
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1103
Species: Hu
Applications: WB, IHC, ICC
AF7817
Species: Hu, Mu, Rt
Applications: WB
NBP1-87835
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29936
Species: Hu, Mu
Applications: WB, Flow, IHC-P
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
MAB7389
Species: Mu
Applications: WB, IHC
AF23151
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-48549
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP2-19775
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-53171
Species: Hu
Applications: WB

Publications for alpha-Aminoadipate Aminotransferase Antibody (NBP1-53171) (0)

There are no publications for alpha-Aminoadipate Aminotransferase Antibody (NBP1-53171).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha-Aminoadipate Aminotransferase Antibody (NBP1-53171) (0)

There are no reviews for alpha-Aminoadipate Aminotransferase Antibody (NBP1-53171). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alpha-Aminoadipate Aminotransferase Antibody (NBP1-53171) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional alpha-Aminoadipate Aminotransferase Products

Bioinformatics Tool for alpha-Aminoadipate Aminotransferase Antibody (NBP1-53171)

Discover related pathways, diseases and genes to alpha-Aminoadipate Aminotransferase Antibody (NBP1-53171). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alpha-Aminoadipate Aminotransferase Antibody (NBP1-53171)

Discover more about diseases related to alpha-Aminoadipate Aminotransferase Antibody (NBP1-53171).
 

Pathways for alpha-Aminoadipate Aminotransferase Antibody (NBP1-53171)

View related products by pathway.

PTMs for alpha-Aminoadipate Aminotransferase Antibody (NBP1-53171)

Learn more about PTMs related to alpha-Aminoadipate Aminotransferase Antibody (NBP1-53171).
 

Research Areas for alpha-Aminoadipate Aminotransferase Antibody (NBP1-53171)

Find related products by research area.

Blogs on alpha-Aminoadipate Aminotransferase

There are no specific blogs for alpha-Aminoadipate Aminotransferase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alpha-Aminoadipate Aminotransferase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AADAT
Entrez
Uniprot