alpha Adaptin Antibody (8R8B6)

Western Blot: alpha Adaptin Antibody (8R8B6) [NBP3-16402] - Western blot analysis of extracts of various cell lines, using alpha Adaptin Rabbit mAb (NBP3-16402) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunocytochemistry/Immunofluorescence: alpha Adaptin Antibody (8R8B6) [NBP3-16402] - Immunofluorescence analysis of C6 cells using alpha Adaptin Rabbit mAb (NBP3-16402) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: alpha Adaptin Antibody (8R8B6) [NBP3-16402] - Confocal imaging of NIH/3T3 cells using alpha Adaptin Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clone: 8R8B6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

alpha Adaptin Antibody (8R8B6) Summary

• Description: Novus Biologicals Rabbit alpha Adaptin Antibody (8R8B6) (NBP3-16402) is a recombinant monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human alpha Adaptin (O95782). MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLFISV
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: AP2A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:1000 - 1:2000
• Theoretical MW: 108 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for alpha Adaptin Antibody (8R8B6)

• 100 kDa coated vesicle protein A
• Adapter-related protein complex 2 alpha-1 subunit
• Adaptor protein complex AP-2 subunit alpha-1
• adaptor-related protein complex 2, alpha 1 subunit
• ADTAAAP2-ALPHA
• alpha1-adaptin
• Alpha-adaptin A
• AP-2 complex subunit alpha-1
• CLAPA1adaptin, alpha A
• Clathrin assembly protein complex 2 alpha-A large chain
• clathrin-associated/assembly/adaptor protein, large, alpha 1
• Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit

Background

AP2A1, also known as AP-2 complex subunit alpha-1, contains a 208 kDa and a 105 kDa isoform, and is involved in protein transport, vesicle formation, and clathrin-dependent endocytosis. Current research is being conducted on the relationship between AP2A1 and a variety of diseases and disorders, including seminoma, neuronitis, Huntington's disease, malaria, myeloid leukemia, carcinoma, gout, immunodeficiency, pancreatic cancer, prostatitis, prostate carcinoma, cholesterol, breast cancer, leukemia, and pancreatitis. AP2A1 is associated with Clathrin-dependent protein traffic, CTLA4 Signaling, p38 Signaling, the EGFR1 Signaling Pathway, the Synaptic Vesicle Pathway, the Arf1 pathway, and L1CAM interactions. The protein interacts with HIP1, TOE1, SMAD9, NUMB, and GRB2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AP2A1