alpha 2-Macroglobulin-like 1/A2ML1 Antibody - Azide and BSA Free

Western Blot: alpha 2-Macroglobulin-like 1/A2ML1 Antibody [H00144568-B01P] - Analysis of A2ML1 expression in transfected 293T cell line by A2ML1 MaxPab polyclonal antibody. Lane1: A2ML1 transfected lysate (17.38 KDa). Lane2: Non-transfected lysate.

Western Blot: alpha 2-Macroglobulin-like 1/A2ML1 Antibody [H00144568-B01P] - Analysis of A2ML1 expression in transfected 293T cell line by A2ML1 polyclonal antibody. Lane1:A2ML1 transfected lysate(17.38 KDa). Lane2:Non-transfected lysate.

• Reactivity: Hu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

alpha 2-Macroglobulin-like 1/A2ML1 Antibody - Azide and BSA Free Summary

• Immunogen: A2ML1 (AAH93840.1, 1 a.a. - 158 a.a.) full-length human protein. MYTLEASGQGCVYVQTVLRYNILPPTNMKTFSLSVEIGKARCEQPTSPRSLTLTIHTSYVGSRSSSNMAIVEVKMLSGFSPMEGTNQLLLQQPLVKKVEFGTDTLNIYLDELIKNTQTYTFTISQSVLVTNLKPATIKVYDYYLPDEQATIQYSDPCE
• Specificity: A2ML1 - alpha-2-macroglobulin-like 1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: A2ML1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for alpha 2-Macroglobulin-like 1/A2ML1 Antibody - Azide and BSA Free

• A2ML1
• alpha 2Macroglobulin like 1
• alpha 2-Macroglobulin-like 1
• alpha-2-macroglobulin-like 1
• alpha-2-macroglobulin-like protein 1
• C3 and PZP-like, alpha-2-macroglobulin domain containing 9
• CPAMD9

Background

The alpha-macroglobulin (AM) superfamily of proteins contains both complement components and protease inhibitors, including A2M (MIM 103950) and A2ML1. AM proteins display a unique trap mechanism of inhibition, by which the AM inhibitor undergoes a major conformational change upon its cleavage by a protease, thus trapping the protease and blocking it from subsequent substrate binding (Galliano et al., 2006 [PubMed 16298998]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for alpha 2-Macroglobulin-like 1/A2ML1 Antibody (H00144568-B01P)(2)

Publications using H00144568-B01P

• Poot AM, Diercks GF, Kramer D et al. Laboratory diagnosis of paraneoplastic pemphigus. Br J Dermatol. 2013-06-25 [PMID: 23796242]
• Schepens I, Jaunin F, Begre N et al. The protease inhibitor alpha-2-macroglobulin-like-1 is the p170 antigen recognized by paraneoplastic pemphigus autoantibodies in human. PLoS One. 2010-08-18 [PMID: 20805888]

Bioinformatics

• Gene Symbol: A2ML1
• Entrez:
  • 144568(Human)
• Uniprot:
  • AAH93840.1(Human)