Alkaline Phosphatase, Tissue Non-Specific Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Alkaline Phosphatase, Tissue Non-Specific Antibody - BSA Free (NBP1-91659) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPGYKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYVPHVMAYAACIGANL |
| Predicted Species |
Mouse (94%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ALPL |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Alkaline Phosphatase, Tissue Non-Specific Antibody - BSA Free
Background
Undifferentiated human Embryonal Carcinoma (EC) and Embryonic Stem (ES) cells have been shown to express very high levels of Alkaline Phosphatase isozyme that is indistinguishable from the isozyme found in liver, bone and kidney. Expression levels of AP decrease following stem cell differentiation. This clone can be used to monitor the expression of the Human Liver / Bone / Kidney isozyme of Alkaline Phosphatase (AP), and hence the differentiation status of human EC and ES cells by flow cytometry.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Ch, Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: ICC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC-P
Species: Dr, Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC
Publications for Alkaline Phosphatase, Tissue Non-Specific Antibody (NBP1-91659) (0)
There are no publications for Alkaline Phosphatase, Tissue Non-Specific Antibody (NBP1-91659).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Alkaline Phosphatase, Tissue Non-Specific Antibody (NBP1-91659) (0)
There are no reviews for Alkaline Phosphatase, Tissue Non-Specific Antibody (NBP1-91659).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Alkaline Phosphatase, Tissue Non-Specific Antibody (NBP1-91659) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Alkaline Phosphatase, Tissue Non-Specific Products
Research Areas for Alkaline Phosphatase, Tissue Non-Specific Antibody (NBP1-91659)
Find related products by research area.
|
Blogs on Alkaline Phosphatase, Tissue Non-Specific