Alkaline Phosphatase/ALPL Antibody (10B1M5)

Immunohistochemistry: Alkaline Phosphatase/ALPL Antibody (10B1M5) [Alkaline Phosphatase/ALPL] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Alkaline Phosphatase/ALPL Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Alkaline Phosphatase/ALPL Antibody (10B1M5) [Alkaline Phosphatase/ALPL] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Alkaline Phosphatase/ALPL Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Alkaline Phosphatase/ALPL Antibody (10B1M5) [Alkaline Phosphatase/ALPL] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using Alkaline Phosphatase/ALPL Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Alkaline Phosphatase/ALPL Antibody (10B1M5) [Alkaline Phosphatase/ALPL] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using Alkaline Phosphatase/ALPL Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Western Blot: Alkaline Phosphatase/ALPL Antibody (10B1M5) [NBP3-15273] -Analysis of various lysates using Alkaline Phosphatase (ALPL) Rabbit mAb at 1:5000 dilution incubated overnight at 4℃.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clone: 10B1M5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Alkaline Phosphatase/ALPL Antibody (10B1M5) Summary

• Description: Novus Biologicals Rabbit Alkaline Phosphatase/ALPL Antibody (10B1M5) (NBP3-15273) is a recombinant monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Alkaline Phosphatase/ALPL (P05186). MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAARILKGQLHHNPGEETRLEMDKFPFVALSKT
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ALPL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunohistochemistry 1:200 - 1:2000
  • Immunohistochemistry-Paraffin 1:200 - 1:2000
  • Western Blot 1:5000 - 1:30000
• Theoretical MW: 57 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Alkaline Phosphatase/ALPL Antibody (10B1M5)

• Akp2
• Alkaline phosphatase liver/bone/kidney isozyme
• alkaline phosphatase, liver/bone/kidney
• alkaline phosphatase, tissue-nonspecific isozyme
• alkaline phosphomonoesterase
• ALPL
• APTNAP
• AP-TNAP
• EC 3.1.3.1
• FLJ40094
• FLJ93059
• glycerophosphatase
• HOPS
• liver/bone/kidney-type alkaline phosphatase
• MGC161443
• tissue-nonspecific ALP
• TNAP
• TNSALP
• TNSALPMGC167935

Background

Alkaline phosphatase (ALP) removes phosphate groups from the 5' end of DNA and RNA, and from proteins, at high pH. Most mammals have 4 different isozymes: placental, placental like, intestinal and non tissue specific (found in liver, kidney and bone). Tissues with particularly high concentrations of ALP include the liver, bile ducts, placenta, and bone. Damaged or diseased tissue releases enzymes into the blood, so serum ALP measurements can be abnormal in many conditions, including bone disease and liver disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ALPL