Alix Recombinant Protein Antigen

Images

 
There are currently no images for Alix Recombinant Protein Antigen (NBP3-17682PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Alix Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Alix

Source: E. coli

Amino Acid Sequence: LDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PDCD6IP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17682.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Alix Recombinant Protein Antigen

  • AIP1DRIP4
  • ALG-2 interacting protein 1
  • ALG-2 interacting protein X
  • ALG-2-interacting protein 1
  • alinx
  • Alix
  • apoptosis-linked gene 2-interacting protein X
  • dopamine receptor interacting protein 4
  • HP95
  • KIAA1375
  • MGC17003
  • PDCD6-interacting protein
  • programmed cell death 6 interacting protein
  • programmed cell death 6-interacting protein

Background

Alix encodes a protein thought to participate in programmed cell death. Studies using mouse cells have shown that overexpression of this protein can block apoptosis. In addition, the product of this gene binds to the product of the PDCD6 gene, a protein required for apoptosis, in a calcium-dependent manner. This gene product also binds to endophilins, proteins that regulate membrane shape during endocytosis. Overexpression of this gene product and endophilins results in cytoplasmic vacuolization which may be partly responsible for the protection against cell death.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6015
Species: Hu, Mu, Rt
Applications: WB
NBP2-77452
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-49557
Species: Hu
Applications: IHC,  IHC-P
NBP1-91782
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-27784
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-85615
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF7117
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-00527
Species: Ca, Hu, Pm, Mu, Pm
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NBP1-71702
Species: Ch, Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP2-32665
Species: Hu
Applications: IHC,  IHC-P, WB
MAB8170
Species: Hu, Mu, Rt
Applications: IHC, KO, mIF, Simple Western, WB
NBP2-20881
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-49118
Species: Hu
Applications: IHC,  IHC-P
NBP1-84158
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-17682PEP
Species: Hu
Applications: AC

Publications for Alix Recombinant Protein Antigen (NBP3-17682PEP) (0)

There are no publications for Alix Recombinant Protein Antigen (NBP3-17682PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Alix Recombinant Protein Antigen (NBP3-17682PEP) (0)

There are no reviews for Alix Recombinant Protein Antigen (NBP3-17682PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Alix Recombinant Protein Antigen (NBP3-17682PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Alix Products

Research Areas for Alix Recombinant Protein Antigen (NBP3-17682PEP)

Find related products by research area.

Blogs on Alix.

Tools for Isolation, Quantification and Analysis of Exosomes
Exosomes are spherical to cup-shaped bilayered membrane enclosed nanosize vesicles (30-100 nm) which have the ability to shuttle active cargoes between cells. Johnstone et al. 1987 pioneered in documenting the generation of exosomes in differentiat...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Alix Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PDCD6IP