ALG5 Antibody - BSA Free

Western Blot: ALG5 Antibody [NBP1-88767] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunocytochemistry/Immunofluorescence: ALG5 Antibody [NBP1-88767] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.

Immunohistochemistry-Paraffin: ALG5 Antibody [NBP1-88767] - Staining of human rectum shows cytoplasmic positivity in glandular cells.

Western Blot: ALG5 Antibody [NBP1-88767] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ALG5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ALG5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 37 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  ALG5 Protein (NBP1-88767PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ALG5 Antibody - BSA Free

• Alg5, S. cerevisiae, homolog of
• asparagine-linked glycosylation 5 homolog (S. cerevisiae, dolichyl-phosphatebeta-glucosyltransferase)
• asparagine-linked glycosylation 5 homolog (yeast, dolichyl-phosphatebeta-glucosyltransferase)
• asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferasehomolog (S. cerevisiae)
• Asparagine-linked glycosylation protein 5 homolog
• bA421P11.2
• dolichyl phosphate glucosyltransferase
• dolichyl-phosphate beta-glucosyltransferase
• dolP-glucosyltransferase
• EC 2.4.1
• EC 2.4.1.117
• RP11-421P11.2

Background

ALG5, also known as Dolichyl-phosphate beta-glucosyltransferase, has a 37 kDa and a 34 kDa isoform, and is involved in the process of substrate recognition. Disease research is currently being conducted on ALG5 and its relation to the congenital disorder of glycosylation. The protein has been linked to several protein metabolism, biosynthesis, and modification pathways, where it interacts with ACER3, DDOST, PIGK, RPN1, and ALG12.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ALG5
• Entrez:
  • 29880(Human)
• Uniprot:
  • Q9Y673(Human)