ALG5 Antibody

Images

 
Western Blot: ALG5 Antibody [NBP1-88767] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: ALG5 Antibody [NBP1-88767] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: ALG5 Antibody [NBP1-88767] - Staining of human rectum shows cytoplasmic positivity in glandular cells.
Western Blot: ALG5 Antibody [NBP1-88767] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALG5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALG5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ALG5 Protein (NBP1-88767PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALG5 Antibody

  • Alg5, S. cerevisiae, homolog of
  • asparagine-linked glycosylation 5 homolog (S. cerevisiae, dolichyl-phosphatebeta-glucosyltransferase)
  • asparagine-linked glycosylation 5 homolog (yeast, dolichyl-phosphatebeta-glucosyltransferase)
  • asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferasehomolog (S. cerevisiae)
  • Asparagine-linked glycosylation protein 5 homolog
  • bA421P11.2
  • dolichyl phosphate glucosyltransferase
  • dolichyl-phosphate beta-glucosyltransferase
  • dolP-glucosyltransferase
  • EC 2.4.1
  • EC 2.4.1.117
  • RP11-421P11.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-62494
Species: Hu
Applications: WB
NBP1-05034
Species: Hu
Applications: WB, PEP-ELISA
NBP2-47550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14281
Species: Hu
Applications: WB, IHC, IHC-P
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-91577
Species: Hu
Applications: WB, IHC, IHC-P
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NBP2-12071
Species: Mu
Applications: WB, IHC, IHC-Fr
NBP1-80835
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89111
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85715
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
46780002
Species: Hu
Applications: ELISA
NBP1-88767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ALG5 Antibody (NBP1-88767) (0)

There are no publications for ALG5 Antibody (NBP1-88767).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALG5 Antibody (NBP1-88767) (0)

There are no reviews for ALG5 Antibody (NBP1-88767). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ALG5 Antibody (NBP1-88767) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALG5 Products

Bioinformatics Tool for ALG5 Antibody (NBP1-88767)

Discover related pathways, diseases and genes to ALG5 Antibody (NBP1-88767). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALG5 Antibody (NBP1-88767)

Discover more about diseases related to ALG5 Antibody (NBP1-88767).
 

Pathways for ALG5 Antibody (NBP1-88767)

View related products by pathway.

PTMs for ALG5 Antibody (NBP1-88767)

Learn more about PTMs related to ALG5 Antibody (NBP1-88767).

Blogs on ALG5

There are no specific blogs for ALG5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALG5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALG5
Entrez
Uniprot