ALG10 Antibody - BSA Free

Western Blot: ALG10 Antibody [NBP2-84420] - WB Suggested Anti-ALG10 Antibody. Titration: 1.0 ug/ml. Positive Control: Placenta

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ALG10 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ALG10. Peptide sequence: AVFCAGNVIAQKLTEAWKTELQKKEDRLPPIKGPFAEFRKILQFLLAYSM The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ALG10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ALG10 Antibody - BSA Free

• ALG10A
• alpha-1,2-glucosyltransferase ALG10-A
• alpha-1,2-glucosyltransferase)
• Alpha-2-glucosyltransferase ALG10-A
• alpha2-glucosyltransferase
• asparagine-linked glycosylation 10 homolog (yeast
• asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog (S.pombe)
• asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog(yeast)
• Asparagine-linked glycosylation protein 10 homolog A
• derepression of ITR1 expression 2 homolog
• DIE2
• EC 2.4.1
• EC 2.4.1.-
• EC 2.4.1.16
• FLJ14751
• KCR1
• potassium channel regulator 1

Background

ALG10 - asparagine-linked glycosylation 10 homolog (yeast, alpha-1,2-glucosyltransferase)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ALG10