Aldo-keto Reductase 1C1/AKR1C1 Antibody - BSA Free

Western Blot: Aldo-keto Reductase 1C1/AKR1C1 Antibody [NBP1-68877] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.

Immunohistochemistry: Aldo-keto Reductase 1C1/AKR1C1 Antibody [NBP1-68877] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

• Reactivity: Hu, Pm
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Aldo-keto Reductase 1C1/AKR1C1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human AKR1C1 (NP_001344). Peptide sequence: DSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPAL The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AKR1C1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 36 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Aldo-keto Reductase 1C1/AKR1C1 Antibody - BSA Free

• 20 alpha-hydroxysteroid dehydrogenase
• 20-ALPHA-HSD
• 20-alpha-hydroxysteroid dehydrogenase
• 2-ALPHA-HSD
• AKR1C1
• Aldo-keto Reductase 1C1
• aldo-keto reductase family 1 member C1
• aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha(3-alpha)-hydroxysteroid dehydrogenase)
• AldoketoReductase 1C1
• C9
• Chlordecone reductase homolog HAKRC
• DD1/DD2
• DD1MGC8954
• DDH1
• DDHH-37
• dihydrodiol dehydrogenase 1
• Dihydrodiol dehydrogenase 1/2
• dihydrodiol dehydrogenase isoform DD1
• EC 1.1.1
• EC 1.1.1.-
• EC 1.1.1.112
• EC 1.1.1.149,2-ALPHA-HSD
• EC 1.3.1.20
• HAKRC
• HAKRCDDH1aldo-keto reductase C
• HBAB
• hepatic dihydrodiol dehydrogenase
• High-affinity hepatic bile acid-binding protein
• Indanol dehydrogenase
• MBAB
• Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
• type II 3-alpha-hydroxysteroid dehydrogenase

Background

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AKR1C1
• Entrez:
  • 1645(Human)
• Uniprot:
  • Q04828()